(data stored in ACNUC7421 zone)

EMBL: CP000431.PE12

CP000431.PE12        Location/Qualifiers
FT   CDS_pept        complement(21689..21916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00012"
FT                   /product="probable glutaredoxin-like protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0045454 - cell redox homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91848"
FT                   /db_xref="GOA:Q0SKT8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT8"
FT                   /protein_id="ABG91848.1"
FT                   /translation="MTITIYSKPACVQCTATYRALDNEGLDYTIVDITRDPDAHDYVLG
FT                   LGYLQAPVIVVGDDHWAGFRPDRIRALAAA"
     atgaccatca cgatctacag caagccggcc tgcgtgcaat gcaccgccac ctaccgcgcc        60
     ctggacaacg aggggctcga ctacacgatc gtcgacatca cccgagaccc tgacgcccat       120
     gactacgtgc tgggtctcgg ctacctgcag gcccctgtca tcgtggtggg tgacgaccat       180
     tgggcgggtt tccggcccga tcgcatcagg gccctcgcgg cagcctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page