(data stored in ACNUC7421 zone)

EMBL: CP000431.PE121

CP000431.PE121       Location/Qualifiers
FT   CDS_pept        complement(124505..125488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00121"
FT                   /product="probable magnesium and cobalt transport protein"
FT                   /note="tc: 1.A.35; GO_function: GO:0015082 - di-,
FT                   tri-valent inorganic cation transporter activity;
FT                   GO_function: GO:0046873 - metal ion transporter activity;
FT                   GO_process: GO:0030001 - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91957"
FT                   /db_xref="GOA:Q0SKH9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91957.1"
FT                   /translation="MDVRFISRDDVRSCAVTELRALLDRPDGLVWVDVPTWDEQANDAL
FT                   TTIFGFHPLAVRDSMNRNQVPKVHRYEDHFFVVLHAPQSGAHGHVHYVELDQFIGGRYL
FT                   VTVHGPVNPAIDPATAMVEVNAVLGRLKSGKLQPSNAFELSFAVLAALTARMRAYTAEL
FT                   TKDVWKLEQQVTGGHLGNPETFLDEMFRVRHGLLTVGTMAALSREVYGRMVTIEAFGAG
FT                   KGQDLLLDAVDQFQHLTVMAKGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAAVTLPI
FT                   TALSSIIGMNVIVNERTQWLSVAAIVLVMLAMSGALLVWAKRKGWF"
     atggacgtcc gcttcatctc ccgtgacgat gtgcgttcgt gtgcggtgac agaactgagg        60
     gcgttgctcg accggcccga cggattggtc tgggtggatg tcccgacctg ggacgagcag       120
     gcgaacgacg cattgaccac gattttcggc ttccatcctc tcgccgtgcg ggattcgatg       180
     aaccgcaatc aggtgccgaa ggtgcacagg tatgaggacc acttcttcgt ggttctgcac       240
     gcgccgcagt cgggagcgca cgggcacgtg cactacgtcg aactggacca gttcatcggc       300
     ggccggtacc tggtcaccgt gcacggcccg gtgaatccag cgatcgatcc cgcgaccgca       360
     atggtcgagg tgaatgcggt gctgggccgg ttgaagtcgg gaaagttgca gccgagcaac       420
     gcattcgagt tgtccttcgc agtgctcgcc gcattgacgg ctcggatgcg ggcgtacacc       480
     gccgagttga ccaaggacgt gtggaagctc gagcaacagg tcaccggcgg gcacctcggt       540
     aatccggaaa cctttctcga cgagatgttc cgggtccgac acggtctgct cacggtcggc       600
     accatggccg cgctgagccg agaggtctac ggccgcatgg tcaccatcga ggcgttcggc       660
     gccggcaagg ggcaggacct cctcctagac gcggtcgacc agttccagca tctgaccgtg       720
     atggccaagg gccagaagga ctacctccag ggcacgatcg agttctacca ggcacgcacg       780
     aacaccaaaa tgaccattgc cgccgagcga ctcgccgtca tcgcggccgt cacgttgccg       840
     atcacggcgt tgtcttcgat catcggcatg aatgtgatcg tgaacgaacg gacgcaatgg       900
     ctctcggttg ccgcgatcgt gctcgtgatg ctcgcgatgt ccggggcact actcgtctgg       960
     gcgaagcgta aaggctggtt ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page