(data stored in ACNUC7421 zone)

EMBL: CP000431.PE122

CP000431.PE122       Location/Qualifiers
FT   CDS_pept        125574..125984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91958"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91958.1"
FT                   /translation="MVDDKIALVVVDAANVVGSRPDGWWRDRAGAARQLLAKLGTLEQR
FT                   LDRPAEVVVVLEGAAKAAVTGETNPEFEGLHVVSAPGSGDDAIVDVVAAAAEEDGDRPI
FT                   TVVTADRELRDRVEALGATTIGPRWLLDRINT"
     gtggttgacg acaaaattgc gctggttgtg gtggatgctg cgaacgtcgt cggctcgcga        60
     cccgacggtt ggtggcgtga tcgtgccggt gcggcccgac aattgctcgc caagctcggc       120
     accctcgaac agcgcctgga ccggccggcc gaggtggtgg tcgtcctcga gggcgcggcg       180
     aaggccgcgg tcaccggtga gaccaacccg gaattcgagg gtctgcacgt ggtgtcggcg       240
     cccggttcgg gcgacgacgc gatcgtcgat gtggtggccg cagccgccga ggaggacggc       300
     gaccggccga tcaccgtcgt caccgcagac cgagaactcc gcgaccgagt cgaggcgctc       360
     ggggccacca cgatcggtcc gcgctggctc ctggaccgca tcaacaccta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page