(data stored in ACNUC7421 zone)

EMBL: CP000431.PE126

CP000431.PE126       Location/Qualifiers
FT   CDS_pept        130535..130804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91962"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91962.1"
FT                   /translation="MSAVSKAMYKPLALAASVAGGIAASALFGQVWKRVAGEAEAPDPK
FT                   DLSRSTREVLIAAAVQGTVFGLVKAAVDRAGAQGYRKLAHDDPR"
     atgagtgccg tgtcgaaggc aatgtacaaa ccgttggcgc tggccgcgag tgtcgccggc        60
     ggaatcgcgg caagcgcgct cttcggtcag gtgtggaagc gcgtcgccgg cgaagccgag       120
     gctcccgacc ccaaggatct ctcacgcagc acccgcgagg tgctgatcgc ggcggccgtg       180
     cagggcaccg tattcggcct ggtcaaggca gcggtagacc gtgcaggcgc gcagggatac       240
     cggaagctgg cccacgacga cccccggtag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page