(data stored in ACNUC7421 zone)

EMBL: CP000431.PE129

CP000431.PE129       Location/Qualifiers
FT   CDS_pept        complement(132116..132889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91965"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH1"
FT                   /protein_id="ABG91965.1"
FT                   /translation="MDNGTRFREISVAARGTPEDEWQSWLESTRFLPVPLAECDRLVVV
FT                   APHPDDEVLGVGALMATAAAAGIPVVVVAVTDGAASHPDSPTLSPDALAVARIAESTQA
FT                   TALLGAGEPLRLGIPDGGVSAHEHELTTRLVDVLTATSGAGERVWVLATWRDDGHPDHE
FT                   ATGRAAAAACSITGHRLIEYPVWMWHWARPADPAVPWNRIRVLTPAAEILARKRGAVDE
FT                   FRTQILPLSEDPRDAAILPPWVLARLMRTTEWVLW"
     gtggacaacg gcaccagatt ccgggagatc tccgtggccg cgcgcggcac accggaggac        60
     gaatggcagt cgtggctcga gtccacccgt ttcctgccgg taccactcgc ggaatgcgac       120
     cggttggtcg tcgtcgcacc acatcccgac gacgaggtac tcggcgtggg cgcgctgatg       180
     gccaccgccg cggccgccgg catacccgtc gtggtggtgg cggtgacgga cggtgcggcg       240
     tcccacccgg actcgccgac cctgtcgccc gacgcgctgg ccgtcgcacg gatcgcggaa       300
     tcgacccagg cgacagcact gctgggtgcc ggcgaaccac tgcgactcgg aataccggac       360
     ggcggagtga gcgcgcacga gcacgaactc accacccgcc tcgtcgacgt gctcaccgcg       420
     acctccgggg cgggggagag agtgtgggtg ctcgcgacct ggcgagacga cggccatccc       480
     gatcacgaag ccaccggacg agctgcagca gcagcatgtt cgatcaccgg tcaccgactg       540
     atcgaatatc cggtctggat gtggcactgg gcccggcccg ccgatccggc ggtgccctgg       600
     aaccggatac gcgtgctgac cccggccgcc gagatcctgg cacgcaaacg cggtgccgtc       660
     gacgaattcc ggacccagat cctcccgctg tccgaggacc cgcgggacgc cgcgatcctc       720
     ccgccgtggg tgctcgcgag actgatgcgg acaacggaat gggtgctgtg gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page