(data stored in ACNUC7421 zone)

EMBL: CP000431.PE132

CP000431.PE132       Location/Qualifiers
FT   CDS_pept        complement(134575..135066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00132"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0001760 -
FT                   aminocarboxymuconate-semialdehyde decarboxylase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91968"
FT                   /db_xref="GOA:Q0SKG8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG8"
FT                   /protein_id="ABG91968.1"
FT                   /translation="MAPLVCGFDPTDRPRGRIEFVWNRTGRWAGVGEVMFRHDDLTSLT
FT                   VGEVPSPDHAAMDDVLDFCSEKEVPISIHHDSASMGLPGRHEYIGALERALERHRSTSV
FT                   VWCHAGVSRRVGPNGQLDLVRELLLRHPNLTVELSWVLLDRIVDGPDVAVGNAERSWFP
FT                   "
     gtggcgccgc tcgtctgcgg gttcgatccc accgatcgcc ctcgcggtcg gatcgaattc        60
     gtgtggaacc gcaccggtcg ctgggccggt gtcggtgagg tgatgttccg ccacgacgac       120
     ctcacgagtc tcaccgtcgg cgaagtaccc tctcccgatc acgcagcgat ggacgacgtc       180
     ctcgacttct gctccgagaa ggaggtgccg atctcgatcc accacgattc cgcgtcgatg       240
     gggctgccag ggcggcacga atacatcggc gcgctcgagc gagctctcga acggcatcgg       300
     tcgacctccg tcgtgtggtg tcacgcaggg gtgtcccgcc gggtgggccc caacggacag       360
     ttggacctgg tccgcgaact tttgctgcgg cacccgaact tgaccgtcga actgtcgtgg       420
     gtgctgttgg accggatcgt cgacggcccc gatgtcgccg tcggcaacgc cgaacgatcg       480
     tggttcccct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page