(data stored in ACNUC7421 zone)

EMBL: CP000431.PE136

CP000431.PE136       Location/Qualifiers
FT   CDS_pept        complement(138952..139272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91972"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG4"
FT                   /protein_id="ABG91972.1"
FT                   /translation="MTTQTTEEPEEAFGTDWLRLALRRCDLLAQMHSVSSDARWMISFA
FT                   IQWAPFGGASAAELLERFGVSRRRFMELVFEGLAPKSTDVQKIRAMKSHLRTSLAQAWG
FT                   VQ"
     atgacgaccc agaccacaga ggaaccggag gaagcgttcg gcaccgattg gctgcgcctg        60
     gcgcttcgcc gatgcgatct gctcgcgcag atgcactcgg tgagctcgga tgcccggtgg       120
     atgatcagct tcgcgatcca gtgggcaccg ttcggtggtg ccagcgcggc ggaactgctg       180
     gagcgattcg gtgtcagccg ccgacgcttc atggaactcg tattcgaggg actcgcaccg       240
     aagtccaccg atgtccagaa gatccgtgcg atgaaaagtc acctgcgcac gtccctcgcg       300
     caggcgtggg gcgtgcagta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page