(data stored in ACNUC7421 zone)

EMBL: CP000431.PE137

CP000431.PE137       Location/Qualifiers
FT   CDS_pept        complement(139278..139739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91973"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91973.1"
FT                   /translation="MSCVDRGKPNGRRRGGAGIHGGDGMTTDGMTRWQGLAQKCELMIQ
FT                   RCLNCTTLLAPLMATCSACQGSNLERVPSCGVGSIVSSKVVHREVNETDRGLVPCTIAI
FT                   VELDEGPWVYTWIDGDVPAPSDCPVRVEFRPASTAEQLPVFAVRSAGQR"
     gtgtcttgtg tggatcgggg gaaaccgaat ggcagacgac gtggtggggc aggaattcac        60
     gggggtgacg gcatgaccac ggacggcatg acccgctggc agggacttgc ccagaagtgc       120
     gaactgatga tccagcgctg cctcaactgc acgaccctgc tcgcgccgtt gatggccacc       180
     tgctccgcgt gtcagggttc gaacctcgag cgggtcccgt cgtgcggcgt cggatcgatc       240
     gtgtcctcga aggtggtcca ccgtgaagtg aacgagaccg accgtggtct cgtcccctgc       300
     acgatcgcga tcgtcgaact cgacgagggg ccgtgggtgt acacctggat cgacggcgac       360
     gtcccggcac cgtccgactg tccggttcgc gtcgagttcc gtcccgcgtc gacggcggaa       420
     cagttgccgg tgttcgcggt ccgctccgcc ggtcagcggt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page