(data stored in ACNUC7421 zone)

EMBL: CP000431.PE138

CP000431.PE138       Location/Qualifiers
FT   CDS_pept        complement(139944..142301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00138"
FT                   /product="possible protein kinase/ transcriptional
FT                   regulator, LuxR family protein"
FT                   /note="bifunctional; GO_component: GO:0005622 -
FT                   intracellular; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_function: GO:0004383 - guanylate
FT                   cyclase activity; GO_function: GO:0004674 - protein
FT                   serine/threonine kinase activity; GO_function: GO:0004713 -
FT                   protein-tyrosine kinase activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0006468 -
FT                   protein amino acid phosphorylation; GO_process: GO:0007242
FT                   - intracellular signaling cascade; GO_process: GO:0042829 -
FT                   defense response to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91974"
FT                   /db_xref="GOA:Q0SKG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG2"
FT                   /protein_id="ABG91974.1"
FT                   /translation="MRRGLRVESDGAMPAAVKGTVGNLPHELTSFVGRRREVTEARRLL
FT                   SVSRLVTLAGIGGVGKTRLALRVAADASRAFEDGVWLVELGELDDDTTLVDAVSAALRL
FT                   REQRSGNPEVLLTEYLATRQLLLVLDNCEHVVAAAAALSETLLRGCPELRILATSREPL
FT                   AIGGEAVLRVPPLTVPEPERSSLQGLPQYEAVTLFVERAATAVPEFELTEDNHVAVARI
FT                   CRQLDGLPLAIELAAVRLRVMSAEQILQRLTDRYRLLTVGSRGAPSRQQTLRLCVDWSH
FT                   ELCTEEERELWARLSVFAGGFELDAVEGICAGDLPVENVLDVVASLIDKSILIREESGP
FT                   AVRYHLLETVRDYGREKLQETGEYQSLRRRHRDWYEQLVVQCEAEWIGPRQAMWISRLD
FT                   AETLNVRAALHFCLTEPGEAETGLRIAAALYPYWRARGLLREGRRWLGQLLGRHPGGAS
FT                   RERIEALYVDSVLAGMHGDREAAKALVDEGVLLAERHGDTLMRALVVHAAGCCAMFAGD
FT                   LPRARVCFEEALAEFRDKGNLLQLTWGLLGVALVSGMQGDGAVAKMCGSEIFALTEAHG
FT                   ESVYRGWSLWAAGMAAWQRGHLALADDYVKQGLRLSHLVDDRISACGALEVLAWVAVGS
FT                   GRAQQAAELMGAAEAVAQTVGNPSTVYPNLLVHHAECEQQARAVIGDRAFDDAFDHGMR
FT                   TSFDDAVAHALDEQPPETVSASNGATHLTRREWQVAELVADGLTNKAIAARLVISQRTA
FT                   QGHVEHILAKLGFNSRTQIAAWIVEHAQDPHP"
     gtgcgcaggg ggctgcgagt cgagagtgac ggtgcgatgc cggcggcagt gaagggcaca        60
     gtgggaaatc tgccccacga actgacgagt ttcgtcggcc gtcgccgtga ggtgaccgag       120
     gcgcgacgcc tgctgtccgt gtcccgtctg gtgacgctcg ccgggatcgg cggggtcggg       180
     aagacccggc tggcgttgcg ggtggccgcc gatgcgagtc gcgcattcga ggacggcgtg       240
     tggttggtcg aactggggga gctcgacgac gacacgacac tcgtcgacgc cgtctcggcg       300
     gcactgcgac tgcgcgagca gcgctccggg aacccggagg tgctgctgac cgagtacctc       360
     gccacccggc aactgctgct ggtgctcgac aactgcgagc acgtggtcgc cgcggccgcc       420
     gcgttgtcgg agacgttgtt gcggggctgc ccggagttac ggatcctcgc gacgagccgc       480
     gaaccgctgg ccatcggcgg tgaggcggta ctgcgggtgc cgccgttgac cgtgcccgaa       540
     cccgaacgct cgtcactgca gggcctgccg cagtacgagg cggtgacgtt gttcgtcgag       600
     cgggcggcca cggcagtgcc ggagttcgaa ctcaccgagg acaaccatgt cgcggtggcc       660
     cggatctgcc gccagctgga cgggttgccg ttggcgatcg agctggcggc ggtgcggctg       720
     cgggtgatgt cggcggaaca gatcctgcag cgactgaccg accgctatcg gttgctgacg       780
     gtcggatcgc ggggcgcgcc gagccggcag cagaccctgc ggctgtgcgt cgactggagc       840
     cacgaactgt gcaccgagga ggaacgggag ctgtgggcga gactgtcggt gttcgccggc       900
     ggcttcgaac tggacgcggt ggagggaatc tgcgccggcg acctgccggt ggagaacgtc       960
     ctcgacgtgg tggcgtcgtt gatcgacaag tcgatcctga tccgcgagga gtccgggccg      1020
     gcggtgcgat accacctgct cgagacggtg cgcgactacg gccgcgagaa attgcaggag      1080
     accggggagt accagtcgct gcgccggcgg caccgcgact ggtacgagca attggtggtg      1140
     cagtgcgagg ccgaatggat cggaccccgg caggcgatgt ggatcagccg gctcgacgcg      1200
     gagacgctga acgtgcgggc ggccctccat ttctgcctga ccgagccggg ggaggccgag      1260
     acggggctgc ggatcgccgc cgcactgtac ccgtactggc gtgccagggg actgctccgc      1320
     gagggtcgcc gctggctcgg ccagctgctg ggacggcacc cgggcggcgc aagcagggaa      1380
     cggatcgagg cgctgtacgt cgacagcgtg ctcgcaggca tgcacggcga ccgcgaggcc      1440
     gcgaaagcgc tggtcgacga gggggtcctc ctggccgagc ggcacgggga cacactgatg      1500
     cgtgccctgg tggtccacgc cgccgggtgc tgcgccatgt tcgccgggga cctaccccgc      1560
     gcacgggtct gcttcgagga ggcactcgcc gagttccgcg acaagggcaa cctgctccaa      1620
     ctgacgtggg gactgctcgg ggtggcactg gtcagcggca tgcagggcga cggggcggtg      1680
     gcgaagatgt gcggatccga gatcttcgcg ctcaccgagg cccacggcga gtccgtctac      1740
     cggggctggt cactgtgggc ggcgggaatg gcggcgtggc agcgcggaca cctcgccctc      1800
     gccgacgact acgtgaagca ggggctgcgg ctgtcccacc tggtcgacga ccggatcagc      1860
     gcctgcgggg cactcgaggt gctcgcctgg gtcgccgtcg gctccggccg ggcccagcaa      1920
     gccgccgaac tgatgggcgc cgcggaggcc gtcgcgcaga ccgtcggcaa cccgagcacc      1980
     gtctacccga acctgctcgt ccaccacgcg gaatgcgagc agcaggcacg cgccgtgatc      2040
     ggggaccgcg cattcgacga cgccttcgac cacggtatgc gcacgtcgtt cgacgatgcg      2100
     gtcgcccacg cgctcgacga gcagccaccg gagacggtgt cggcgtcgaa cggggcgacg      2160
     cacctgaccc gacgcgaatg gcaggtcgcg gaactggtcg ccgacgggct caccaacaag      2220
     gcgatcgccg cccggttggt gatctcgcag cgcactgcgc aggggcatgt cgagcacatt      2280
     ctcgccaaac tggggttcaa ctcgcgcacc cagatcgcgg cgtggatcgt cgaacacgca      2340
     caggacccgc acccctga                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page