(data stored in ACNUC7421 zone)

EMBL: CP000431.PE141

CP000431.PE141       Location/Qualifiers
FT   CDS_pept        complement(144521..171307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00141"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.3"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91977"
FT                   /db_xref="GOA:Q0SKF9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF9"
FT                   /protein_id="ABG91977.1"
FT                   /translation="MTSVNSPQPNNGAEDVTVPEGAFPLSSVQRSMWFAQQLSPTVPKF
FT                   IAQYIELRGEIDLDLLSDAAVRAGQEFQSPFLRLLDVDGEPYQAVDFSIDPSIGFLDFR
FT                   GESDPMGAAQVWIDEDYATPLRLTRDRLVEMTVLQVGEQHYLWYTRIHHVALDGYSGMT
FT                   MVNRIAALYTAAVEGTEPEPNRALDLRDLYELDQKYRASSRFENDRLYWAERIVGIEHG
FT                   STLATHDAPAAAKSRLESAKISDTALGFLGESDQRVGATSAAVLLAGFACYLSRMTGKR
FT                   DVLINLPVSARTTAPLQRSGGMLVNVAPLRITVRPEDTVAELVQRTQLELMGALRHQRC
FT                   SLEDIRRDAGLAGTAEGLAGPMVNVMLFHQAFTLGTVTGEYHIVTSGPVDDLLVNIYQS
FT                   GDGQTLLDFRGNPNRYGSEELRAHHRRFVELVEEFVTAEPQTRTADIHAESARLGARFL
FT                   EREAQLAFWKRELAGLPEVAALPLDRPRPAERAGAGEVVGFAVDAEVQRRAALLAEEAG
FT                   TGIFTALHAALAVLLGRLGDTDDVVIGTPIVGREAADSDDPEAGAFFNKTVLRSQVDTA
FT                   SSFVDHLSRVRDADRAAFTHAALPFDDLVAALGAESDPSHTPLFQVMLEFTDGGHPHDS
FT                   SGNVTVSPIQREHRALGLDLVFSLTESESGGINGRLRFATDVWDRASAEALAARFVRIL
FT                   QTVTAEPTAPIGDVDLLEQVEYAELAPVRDEPSVEPRTLPTLLARAVEAGGDGDALVYQ
FT                   GRTLTYPELDAQSDRLARMLIGHGVGPGSVVALAIARSIESVLATWAVAKSGAAFVPVD
FT                   PNYPADRIEHMLTDSGAVVGLTVAAHRSSLPETTPWLVMDDASFGRDLAQHAAGTVADA
FT                   DRLRPLRTADPAYLIYTSGSTGTPKGVVVTHAGLANFAEDERQRFAVTAGSRTLHFSSP
FT                   SFDASILELLLAVGAGATMVVAPSTVYGGTELADLLSRERVTHAFVTPAALASVDPTGL
FT                   DHIRCVVTGGESCPPALVAQWAPGRVMFNAYGPTEATVVASVAGPLTVGEPVTIGRPSR
FT                   GCGLLVLDSRLHPVPRGVPGELYITGDGVARGYHNRSIPTAERFVADPHGAPGERMYRT
FT                   GDLARWNAAGQLEYLGRTDFQVKIRGFRIELGEIDAVVRSHPSVAFATTVGRTAPSGDT
FT                   VLVTYVLPEDGTDIVVGDILEHAAAALPAHMVPARVMVLREVPLTPAGKLDRKALPEPQ
FT                   FEATSTVYRAPVTPTEMQIAEVFAALLGVERIGVDDSFFDLGGDSLVATRVVSRVNAAL
FT                   STEIGVLDLFEAPSVALLSARVDALGPRTSARPVLAPRAGSGPVQVSLAQQRMWFINQL
FT                   DTASPAYNIPVGIRLRGTLDVEALRTAVSDVLTRHESLRTVFPNTPNGPIQVVLPVAEV
FT                   SPHLDAVEVAENELESRLIADAATGFDVTVEPPIRAELYRTATDDHVLVFVVHHIAADG
FT                   LSMTPLTRDVMVAYHARAAGDTPQWAPLEVQYADFAVWQRELLGSPDDPTSLLARQLAF
FT                   WARTLDGAPEVMDLPTDRPRPARQSMIGATADFSIPARIHAALLEIAGANDASLFMVVH
FT                   AALAVLLSRSSGSSDVSIGSPVSGRGERQLDDVVGMFVNTVVLRTTVDPDRSFPEILSH
FT                   TRSVDLAAFSNTDLPYERLVDELKPTRSEAHSPLFQVMLVLQGFANTRLELPGLDVEVE
FT                   ALETGAAKFDLQVILTEHTEESGAPGAIDVQFSYASELFDPPTMTALAERFVTLLETIT
FT                   AGSDAKVGDIDLIGADETHRMLEQWIDTDVAVPDSATLVSLFEAQVARTPDAVAVVFAE
FT                   EELLYAEFDARANRLARELLARGVGPESRVAVALRRSLELMIAIYAVEKTGAAYVPLDP
FT                   DHPASRIAYVIESAEPACVLTSSRDRCEGVDSAAGAAVIEIDTLNLSRRPSTPITAAER
FT                   GGPIHPDSTAYVIYTSGSTGRPKGVAVSHRAIVNRLLWMQDTYRMDHTDVVLQKTPVTF
FT                   DVSVWELFWPLEVGARLVLAAPDGHRDPTYLSHIIADHQVTTMHFVPSMLAVFTAGAEP
FT                   ELCGSLRQVFCSGEALPPATADAFREFGSAALHNLYGPTEAAVDVTYWECTEGDRASVP
FT                   IGAPVWNTQVYVLDSRLHPVPVGVHGELYLAGIQLARGYVGRSDLTSDRFVANPFGAPG
FT                   QRMYRTGDVVRWRADGNIEYIGRRDFQVKLRGQRIELGEVEAAVLAHPSVAQAVVTVHR
FT                   SEATGESLVGYVIPVAGADIDTAVVRDAAAEALPAYMVPTRIIVLDRFPLGATGKLDRG
FT                   ALPEPEFLSPSAEFVTPRNPIEEILASIFADLLDAPRIGVYDSFFDLGGNSLVATRLVA
FT                   RVNAALGSRIGVREIFDAPTVATLATRIESEAVQGAERPPLVAGARPDRLPVSLAQKRM
FT                   WFINQFDLDSPAYNIALAVRLTGDLDEDAMQDAVADVMDRHESLRTRFPMVEGEPVQVI
FT                   LPTEDVVPDLSPIATTEAELPEHISRLAGAGFDVTVSVPVRAALFRTDPGEHVLVIVVH
FT                   HISADGFSMAPLARDVMTAYAARTGGQAPDWTPLPVQYADFALWQHRVLGNADDPDSLL
FT                   AAQLDYWTHTLAGLPELLALPTDHPRPTQQSMRGGIHSFSIDPQVHSRLITTAREHNSS
FT                   VFMAVHAALAVLLARLGDTDDVSVGTPIAGRGDAALDDMVGMFVNTLVLRTPVEPAGTF
FT                   TDLLSTVRDTDLNAFHHADLPFERLVDAISPERATSHSPLFQVVLEFRNNERPRLELPG
FT                   LTVTGLDLATDISNFDLQLTLTEEFGASGEPAGISAAFTYASSLFDASTIAGFADYLQR
FT                   IFDAVTSEPGMAVGDIDLMVASERAALTPVMDGPDAEPRTLPELLAAAASVDPKAAALS
FT                   YEGREVTYRDLDERSNRLARLLIGRGIGPESVVALALARSPESVLSLWAVAKTGAAFVP
FT                   VDPNYPTDRIVHMLSDSGAALALTVAEFRPTLPDCTSYVVVDAPGFDDEVSAHSAAVVT
FT                   DADRTHPLALENPAYLIYTSGSTGTPKGVVVTHRGLANFATDERVRFGVTPRSRTLHFS
FT                   SPSFDASILELLLAVGSGATMVIAPASVIGGTELADVLREGRVTHAFITPAAMASVDPA
FT                   GLDQLECVATGGDVCPPELVAQWVTGGRRMFNAYGPTEATVVSSVTGPMIPGEGVTIGR
FT                   PPMGTGEMVLDSRLHPVPNGVTGELYVSGSGLARGYKDRAGTTAERFVANPYGGLGARM
FT                   YRTGDLARWNGAGQLEYLGRSDFQVKIRGFRIELGEIETALTRYPGVARSVVSAHRGST
FT                   GANRLVGYLVPTAGAELDPEAVLEFVGGFLAPYMVPSALIVLDELPLTPAGKLDRRALP
FT                   EPDFGARVSTGRAPVSEMEEVLAGLFAEVLGLESAGVEDSFFALGGDSIMSIQLVARAK
FT                   AAGVVLTPRDVFEAKTVAGLAAVASWVGAADVVVLDELPGGGVGDMPTTPITKWLLERG
FT                   GEFNRMSQSALLTAPPNLRELEPLSATFQAVLDRHDMLRAQLIVSAEDSHLAVRPVGEV
FT                   DAQDLIRRVPVSTAPGTRAFAATVIAELDAALDRLDPAAGVMVQVVWFDAGESGGRLLV
FT                   VAHHLVVDGVSWRILVPDLATAWAQISAGQEPVLEQVGTSMRRWAHGLVDEAASRAGEL
FT                   DLWQRILDCEDPLVGSRPLDPDIDVNATVGRVTVQLPAEVSEAVLTALPEAIHGSVNDG
FT                   LLTALAMAVTQWRRTRGHTLHGRSVDGTLVSLEGHGREDQVVPGADLGRTVGWFTAMFP
FT                   VRLDLSGIDLDDAFDGGKAAGSAIKAIKEQLLAIPDHGMGYGMLRYLNADTAPLLAARS
FT                   LPQISFNYLGRFAADLSEAATRAGWTPTGEVDMDRAQDLDTPVTSAIDVNAVTTEVEDR
FT                   PQLRATWAYAAGVLTVAEVRELAELWVRALTALTTYAARPDAGGVTPSDLELVSLDQDA
FT                   IDRIESRFPALSDIWSLSPLQSGLLFHALLADQTIDSYTVQVTLELRGAVPSRMRVAGQ
FT                   ALLDRHANLRASFVYDEGGTPVQAIHGSAELPWTEIDLSGLDAESREAEIVRLLDADRR
FT                   RGFDMATPPLLRFMLIQIGGDEQRLIITNHHILLDGWSMPLLIRDLLTLYATEGDATAL
FT                   PRVHPYRDYLAWMSHRSTEDSLGVWQRALAGVEEPTLLAPADASVQSDTQSSELLVELD
FT                   VDRTDQLSVLAREHGLTLSTLIRTAWGIVLGGLVGRSDVVFGGTVSGRPPQIAGIESMV
FT                   GLFINTLPVRVVLDPRETLGELLERIQGEQAALLDHHYVGLTDIQSVAGPGAGFDTLTV
FT                   FESYPVDREGLTDQTDIAGMHVLDVHDSANAAHYPLALIASAHENLQLKLEYVEELFDR
FT                   ADVERIGDRIVRALIALAEHPGMKLAQLRLLTDVEEAELVPARGLPGRSVRTLPQMFAE
FT                   TAAAAGDATALVFGDRRMSYRELDERSNQLARLLIDRGVGPEDIVALGISRSIESVLAV
FT                   WSITKTGAAFVPVDPTYPRERVEHMVTDSGCTFGLRLEADHGRLPDTVRWLTLDDTETA
FT                   TAIRAMSTDTVTDDDRVAPLRFAHPAYVIYTSGSTGKPKGVVVSHRGLDNFAEEQRTRY
FT                   ATDSTSRALHFSSPSFDASVLEYLLSFAVGATMVIVPPSVYGGEELAELIRTEGVTHGF
FT                   VTPAALASVDPEGLEVFQNVVAGGEAVPPELVTRWAPGRTMYNGYGPTETTIMSNLSDH
FT                   LQVGETVTIGAPVRGVSEVILDSRLQPVSVGVAGELYISGEGLARGYHARAGLTSERFV
FT                   ANPYGEPGDRMYRTGDLARWRSDHTVEYLGRTDFQVKIRGFRIELGDIDSALAAHPSVA
FT                   FAVTLGRPGPAGDTVLVSYVLPEAESALEPPELKEWTANLLPAHMVPSSIMILDEIPLT
FT                   PVGKLDRAALPEPQFLPTSDDFRPPSTVLEHTIADVITTVLGIERVGIDDNFFDIGGNS
FT                   LIATRVAARLTAELDTDIGVRTLFEAPTIHQLARLIESTAFAPAQDGAHVRIPLGPMPR
FT                   PAHVPVSLAQKRMWFLNQFDTSSAAYNIPLAVRLTGHLDVESLRAAVTDVFVRHESLRT
FT                   VFPSHDGEPTQVVLSPGQWTPNLEIVEVSEDELREHIAGLATAGFDVTADVPMRSALFA
FT                   LAPDDHVLVIVVHHICADGFSLTPLARDVMTAYAARIAGSAPQWNPLSVQYADYTLWQL
FT                   QLLGDESDAESLISQQLRYWTDQLADLPELLQLPTDRARPVQQSFRGAQVDFTIPADVH
FT                   RALAALARKHNSTMFMAVHAALSVLLSALSSTEDIAVGTPIAGRGDAALDDMVGMFVNT
FT                   LVLRSAVDPAAGFGALMDQVRSTDLAAFHHSDLPFERLVDVLAPERSTAHSPLFQALLE
FT                   FRNNETPRLELPELTAAAVDFDLEVAKFDLQLSVEEGFDADGVASGIAASFIFATDLFD
FT                   AGTVRTFADRFLRILGAVTSDPLAPVGDIVITDAAERSAMATEWNTAGFDAGTDTLADR
FT                   FAQSVARFPDATAVTSEDVALTYAELDARSNRLARLLISQGVGPETLVAVALPRTCDLI
FT                   IALLAVIKTGGGYLPVDITYPADRLAFVFEDAAPNCVITTTGDVSALPDSETPAILLDD
FT                   PETTADLAQQSPATITDADRVTPLDSSSVAYVIYTSGSTGRPKGVVVSHRNVLTLFANT
FT                   QPLYGFDENDVWTMFHSYAFDFSVWELWGPLLYGGRLVVVDYYTARSPEMFHELLRNEQ
FT                   VTVLNQTPTAFYQLAETDRIVSEIDVNAAALALRYVIFGGEALDLGQLGRWYSRHDDSA
FT                   PTLVNMYGITETTVHVSYLALDREFAESASASVIGRGIAGLHVHVLDRRLHPVPPGTIG
FT                   EMYVSGDQVTRGYLGRAGLSSSRFVADPLRPGARMYRTGDLARWNTDGQLEYLGRSDFQ
FT                   VKIRGFRIELGEIESALLRYRGIAQAVVLTRDDGHGGHRLIGYVVPESGATVEVSSALE
FT                   FVGTQLTSYMVPATLVVLDALPLTSNGKLDRRALPEPDFGARVSAGRAPATEMETVLAG
FT                   LFAEVLGLESVGVDDSFFALGGDSIMSIQLVARAKAAGVVLTPRDVFEAKTVAALAEAA
FT                   SWAGAADVVVLDELPGGGIGEMPVTPITAWLLERGGDFRRYTQTALLSLPAAADETLLK
FT                   RTIAAVVDHHDMLRARLLGAEPQWRIEVQAVGVVDVDDVLHRVEVASVVGSGFAEVATR
FT                   ELDAAAGRLDPEAGVMLQMVWFDAGDQGGRLLVVAHHLVVDGVSWRILVPDLATAWAQV
FT                   SAGQEPTLEPVGTSMRRWSHGLVEATRERAGEIELWRRVLEADDPLIGSRPLDAAIDVA
FT                   GTVEKVTVEVPADVTDALLTRVPEAFHGGVNDGLLTALALALAQWRRTHGDFTRESLVS
FT                   LEGHGREDQVLPGADLGRTVGWFTAMFPVRLDLSGIDLDDAFAGGKATGSAVKAIKEQL
FT                   LAIPDHGIGYGMLRYLDPESADQLRALAKPQVTFNYLGRLGGATSTDIHGHAWVPVTDT
FT                   KLDDIPASDIPVASALDINAVTGTGADGNRLRATWAFPTGVLTPSEVRALADLWVQALT
FT                   ALTTHVARPDAGGVTPSDLDLVTLDQDAIDRLEARFPALSDIWSLSPLQSGLLFHAQFS
FT                   DASVDPYLVQLALKLRGNIDPDRIRRAGQALLDRHPNLRAAFVHDSAGASAQIIQQHVE
FT                   LPWSEFDLSALDPDETTREYDRIVARDRSVKFDMANAPLLRLALVRLTEEDYRLILTNH
FT                   HILLDGWSTPLVIRDLLTLYALDADGSLLPRVHSYRDYLSWMKRHDTTDSLDAWRTALD
FT                   GVEEPTLLAPLERGEAHSAVAEETAFTLSEEQTTRLRDLSRERGLTLNTVVQTAWGIVL
FT                   GGLVGRSDVVFGGTVSGRPPQIAGIESMVGLFINTLPVRVTLDPWESLGELLERVQSEQ
FT                   AALLDHHYVGLTDIQSAVGGGGAFDTLTVFESYPVDEAGLTEQTDIAGMFVTGIDGKDS
FT                   AHYPLAVVASGDARLNFKFEYLPEVFEESAVDEIADRLQRVLDALADRPEIPLAHMQLL
FT                   TEAELAEFAPVRGRPGFSVRTLPQIFEDAAALDPNRTALTFEGRNVSYRELNERSNQLA
FT                   RVLISRGAGPETFVALGIPRSIESVLAVWAVAKTGAAFVPVDPNYPMDRIEHMLTDSGA
FT                   TIGLTMAAYEKALPDSVPWLQLDSPKFEKACQSKPALPVADSDRRSPISLDNAAYIVYT
FT                   SGSTGKPKGVVVTHEGLDNFAEDQRQRFAAAQTSRTLHFSTPSFDGSVFEYLQAFGVGA
FT                   TMVIAPPTVYGGAELAELIRSEHVTHAFVTTAALSTVDPTGLDEFQHVVFGGEACPPEL
FT                   VTRWAPGRQLSNAYGPTETTVMANISDPMTVGDPITLGGPIRGVGELVLDSRLQPVPVG
FT                   VPGELYITGAGLARGYHRRPELSSQRFVANPFGEAGERMYRTGDIVRWRADHTVEYVGR
FT                   SDFQVKIRGFRIELGEIDNEIATFPGVSFAATLGVPGPSGDTVLVTYLLPNTAGGVDPA
FT                   ELTAHLSTRLPAHMVPTSVMFLDEIPLTPVGKLDRSALPAPEFHVTTTEFQPPTNDLER
FT                   KIVDIFADVLGIERIGIDDNFFDLGGNSLVATRVTARLRDALDTDIGVRALFEAPDVRS
FT                   LAARVADSVSGGARPALAPVERPDRIPLSLAQKRMWFLNQFDTSSPAYNIPLAVRLTGT
FT                   LDEDALRLAMADVLERHETLRTVFPTVDNEPTQRILPAADAQPGVDTVSVAAEDLPRHI
FT                   MDLVSRGFDVSTDVPVRAALFRIAPDHHVLTIVVHHISADGFSLAPLARDVMVAYTSRL
FT                   GGDGPQWDPLHVQYADYTLWQHAGLGSENDPESMINQQLRFWSETLAGVPDVIQLPTDR
FT                   PRPIQQTFEGDRVEFAIDADLHQRLTALARANNATMFMAVHAALAVLLSRLGSTDDVVI
FT                   GTPVAGRGEAALDDMVGMFVNTLVLRNRIDPASTFTELVQRIRETDLAAFQHSDLPFER
FT                   LVEELNPTRSTSYSPLFQVALEFQNNENPTLELPDLRVENVDLETKVVKEDLEVILAEQ
FT                   FDQDGAPAGVAGGLDFAVSLFDRGTARSIADRFVRILAAVTADPDRPIGTLPLLDEAEI
FT                   EEMVPARGKPDVRPEVWPDLLTAAAALDPDSVALSFEDRQVTYRELDEWSNRLARVLCA
FT                   QGVGPETFVAIGMPRSIEEVVSIWSVAKSGAAFVPVDPTYPRDRIDYMLTDCRASVGLT
FT                   VAGRRDNLPDTVPWLVLDDESFAEQVAAVSSSPVTDADRTRPLHLAHPAYLIYTSGSTG
FT                   KPKGVIVTHRGMANLTAEEHERFQVTHESRVSHLASPSFDASIFELMMAFGASARVVIV
FT                   PPTVFGGTELADLFRRNAVTHAFITPTALSSIEDVGLESLRVLAVAGEACPPELVEIWG
FT                   KHRNMHNGYGPTETTIQASVSAPMRPGGVVNIGAPALGFGSLVLDERLQPVPVGVPGEL
FT                   YITGPGLARGYHNRSALTSERFVACPFGEPGRRMYRTGDVVRWRGDHTIEYIGRTDFQV
FT                   KVRGFRIELGEIDAVLARHPAVAFAATIGHTGPSGDTLLASYVRAAEGHDLEPAELRTH
FT                   AADRLPAHMVPSAVVVLDQIPMTPVGKLDRKALPAPEFGTTGAAFRAPTTATERIIVEA
FT                   FAEVLGVDRVGTADSFFDLGGNSIVATRVITVLQERLGRQIPLQSMFLDPTPAGLALRV
FT                   DTENAAGSPVDEALGVVIPLRPTGDKPPLFCIHPGIGLSWGYAGLLQHLSQDRPAFGLQ
FT                   LPIISGGPSFESIEQLAHQYVLEMRKVQAHGPYHLLGWSLGGVIAHAMAVELRREGEAV
FT                   DTLAVMDSYVTGGTDQGPESLTVPELLHGLGLDLESVSGEELTYERAVELLDDAFGQKT
FT                   GLTPQHLERISAGFTNSSRIMNNFRPQVFDGDLLFFTAAGSASTDQHSPEEWRSSVTGG
FT                   IREVKIECEHNQMIEPEVLAVVGPVLEDYLSAH"
     atgacgagtg tgaattcgcc gcagccgaat aacggcgccg aagatgtgac cgttcccgaa        60
     ggggccttcc cgctctcctc ggtgcaacgc agcatgtggt ttgcccaaca actgagcccc       120
     acggttccca agttcatcgc ccagtacatc gagttgcggg gcgagatcga cctggacctg       180
     ttgagcgatg cggcggtccg ggcgggtcag gagttccagt cgccgttcct gcgactgctg       240
     gacgtcgacg gggagcctta ccaggcggtc gatttcagca tcgacccgtc gatcggcttc       300
     ctcgacttcc ggggcgagtc cgacccgatg ggtgccgcgc aggtgtggat cgacgaggat       360
     tatgcgacac cgctccggct cacccgggac cggctcgtcg agatgaccgt tctccaggtc       420
     ggtgagcagc actacttgtg gtacaccaga attcaccacg tcgcgctcga cgggtacagc       480
     ggtatgacca tggtgaaccg gatcgcggcg ctgtacaccg cggcggtcga gggcaccgaa       540
     ccggaaccga accgtgcgct ggatctgcgc gacctctacg agctggacca gaagtaccgg       600
     gcgtcgagcc gattcgagaa cgatcggttg tactgggccg aacgcattgt cggcatcgag       660
     cacggatcga cgctcgccac ccacgacgcc cccgcggcgg cgaagagccg gctagagagc       720
     gcgaagatct ccgacaccgc actgggcttc ctcggtgagt cggatcagcg ggtcggcgcc       780
     acgtcggcgg ccgtgctgct cgccgggttc gcctgctatc tgtcccggat gacgggcaag       840
     cgggacgtgc tcatcaacct gccggtgtcg gcgcgcacca cggcgccgtt gcagcggtcc       900
     ggtggcatgc tcgtcaacgt cgccccgctg cggatcaccg tccgcccgga ggacacggtg       960
     gccgagctcg tgcagcgaac gcagctcgaa ttgatgggtg cgctgcgcca tcagcggtgc      1020
     agcctcgagg acatccgccg cgatgccggg ctcgccggca ccgcggaggg cctcgccggc      1080
     ccgatggtga acgtcatgct gttccaccag gcgttcacgc tgggcacggt cacgggtgaa      1140
     taccacatcg tgacgtcggg cccggtggac gacctgctgg tcaacatcta tcagagcggt      1200
     gacgggcaga cgctcctcga tttccgcggc aaccccaacc ggtacggctc ggaggagttg      1260
     cgtgcccacc accgcaggtt cgtggagctc gtcgaggagt tcgtcactgc cgagccgcag      1320
     acgcggaccg ccgacattca cgccgagagt gcccgcctcg gtgcgcggtt cctcgagcgg      1380
     gaggcccagc tcgcgttctg gaagcgggag ttggcgggcc tgccggaggt ggcggcactg      1440
     ccgctggacc ggccgcgccc ggccgagcgg gcgggggccg gcgaggtcgt cgggttcgcc      1500
     gtcgacgccg aggtgcagcg ccgcgcggca ctgcttgccg aggaggcggg caccgggatc      1560
     ttcaccgcgc tgcacgccgc gctggccgtt ctgctgggcc ggctgggcga caccgacgac      1620
     gtcgtgatcg gaacgccgat cgtcgggcgc gaggcggccg actccgacga cccggaagcc      1680
     ggagcatttt tcaacaagac cgtcctgcgg tcgcaggtgg acaccgcatc gtcgttcgtc      1740
     gaccacctga gccgggtccg ggacgccgac cgggccgcct tcacgcatgc ggcgctgccc      1800
     ttcgacgacc tcgtcgccgc cctgggagcc gaatccgatc cctcgcacac accgctgttc      1860
     caggtgatgc tcgagttcac cgacggtggg catccgcacg actcgtcggg caacgtgaca      1920
     gtcagcccga tccagcgcga acaccgggcc ctgggtctgg atctcgtgtt ctccctcacc      1980
     gaatcggagt cgggcggcat caacggccgg ttgcggttcg cgacggacgt ctgggaccgc      2040
     gccagcgcgg aggccctggc cgcgcgcttc gtccggatcc tgcagacggt gacggcggaa      2100
     cccaccgcac cgatcgggga cgtcgacctc ctcgagcagg tcgaatacgc ggaactcgcg      2160
     ccggtccgcg acgaaccctc ggtcgagccc cgcacgcttc ccacgttgct cgcgcgcgcc      2220
     gtggaggcgg gcggcgacgg ggacgctctc gtctatcagg gacgcaccct gacctacccc      2280
     gaactcgacg cgcagtcgga ccgtctcgcc cgcatgctga tcgggcacgg ggtggggccg      2340
     ggttcggttg tggcgctggc gatcgcgcgg tcgatcgagt cggtgctggc cacctgggcg      2400
     gtcgcgaagt ccggggccgc gttcgtcccg gtcgacccga actatccggc cgatcgcatc      2460
     gaacacatgc tcaccgattc cggtgcggtc gtcggtctca ccgtggcggc gcaccggtcg      2520
     tcgctgccgg agaccacgcc gtggctcgtg atggacgacg cgtcgttcgg ccgggacctg      2580
     gcgcagcacg cggccggcac ggtcgccgat gccgaccgcc tccggccgct gcggaccgcg      2640
     gacccggcct acctgatcta cacgtccggt tccaccggca cacccaaggg tgtcgtcgtc      2700
     acccacgccg gcctggccaa tttcgccgag gacgagcggc agcggttcgc cgtcaccgcg      2760
     ggatcccgca ccctgcactt ctcgtcaccg agtttcgacg cgtccatcct ggaactgctt      2820
     ctcgcggtgg gtgccggcgc cacgatggtg gtggcgccgt cgacggtgta cggcggtacc      2880
     gaactcgcgg acctgctgag tcgggaacgg gtgacgcacg cgttcgtgac ccccgccgcg      2940
     ctggcatccg tcgatcccac cggcctcgac cacatccggt gcgtcgtcac cggtggtgag      3000
     agctgtcctc ctgcgctggt ggcgcagtgg gcgccggggc gggtcatgtt caacgcatac      3060
     ggcccgaccg aggccaccgt cgtcgcgagc gtggccggac cgttgacggt cggcgaaccg      3120
     gtgacgatcg gccgtccgtc ccgcggttgc ggtctgctgg tgctcgattc gcggttgcac      3180
     cccgttccga gaggggtccc cggcgagctg tacatcaccg gcgacggtgt ggcacgcggg      3240
     taccacaatc ggtcgatccc gaccgccgaa cggttcgtcg ccgaccccca cggggcgccc      3300
     ggcgagcgga tgtaccgcac cggagacctg gcgcggtgga acgctgccgg acagctggaa      3360
     tacctgggcc gcaccgactt ccaggtgaag atccgcgggt tccgcatcga actcggtgag      3420
     atcgacgccg tcgtccgctc gcacccgagt gtggcgttcg cgaccacggt cggacggacc      3480
     gcaccgtccg gcgacaccgt gctggtgacg tacgtgctcc ccgaggacgg gacggacatc      3540
     gtcgtcggcg acatcctcga gcacgccgcg gccgcgctgc ccgcgcacat ggtgcccgcc      3600
     cgggtgatgg tgctccgcga ggtcccgctg accccggcgg gcaaactcga ccggaaggcg      3660
     ttgccggaac cgcagttcga ggccacctcc accgtctacc gggcgccggt gaccccgacc      3720
     gagatgcaga tcgcggaggt gttcgcggcg cttctgggag tcgaacgcat cggcgtcgac      3780
     gacagcttct tcgacctggg cggcgactcc ctcgtcgcga cccgcgtggt gtcccgggtc      3840
     aacgcggccc tcagcacgga gatcggggtg ctcgatctgt tcgaggcgcc cagcgtcgcg      3900
     ttgctcagtg cccgcgtcga cgctctcggg ccccgcacct ccgcccgccc cgtgctcgcg      3960
     ccgcgggccg ggtccggccc ggtgcaggtg tcgctggcgc agcagcggat gtggttcatc      4020
     aaccagctcg acaccgcctc gcccgcatac aacattcccg tcggtatccg gctgcgcggc      4080
     acgctcgacg tggaggcgct gcggaccgcg gtgagtgacg tcctcacccg gcacgagtcg      4140
     ctgcggacgg tgttcccgaa cacccccaac ggtcccattc aggtggttct gccggtcgcg      4200
     gaggtgagcc cgcacctcga cgcggtcgag gtggccgaga acgagctcga atcccgcctg      4260
     atcgccgacg ccgcaaccgg tttcgacgtc accgtcgaac cgccgatccg ggcggagctc      4320
     taccgcaccg cgaccgacga tcacgtgctg gtgttcgtgg tgcaccacat cgccgccgac      4380
     ggcctgtcga tgacaccgct gacccgggac gtgatggtgg cctaccacgc ccgcgccgca      4440
     ggcgacacgc cgcagtgggc accgctcgag gtgcagtacg ccgatttcgc ggtgtggcag      4500
     cgcgagctgc tcggttcccc cgacgatccg acgagcctcc tcgcacgcca gctggcgttc      4560
     tgggcccgca ccctcgacgg cgcccccgag gtcatggatc tgccgaccga ccggccgcgc      4620
     ccggcccggc agtcgatgat cggcgccacc gccgacttct cgatcccggc gcgcatccac      4680
     gccgccctgc tcgagatcgc gggcgccaac gacgccagcc tgttcatggt ggtgcacgcc      4740
     gccctcgcgg tcctgctgtc ccggtcgagc ggatcatccg acgtgtcgat cggatccccg      4800
     gtctccggtc gaggggagcg ccaactcgac gacgtcgtcg gcatgttcgt caacaccgtc      4860
     gtcctgcgca ccaccgtcga ccccgatcgc agcttccccg agattctctc gcacacccgc      4920
     tccgtggatc tggcggcgtt cagcaacacc gatctgccgt acgagcggct cgtcgacgaa      4980
     ctgaagccga cccgctccga ggcacattca ccgctgttcc aggtgatgct ggtgctgcag      5040
     ggattcgcga acacgcggct cgagctgccc gggctcgacg tggaggtcga ggcgctcgag      5100
     accggcgccg cgaagttcga cctgcaggtc atcctcaccg agcacaccga ggaatccggc      5160
     gccccgggtg cgatcgacgt ccaattctcg tacgcgtcgg aattgttcga cccgccgacg      5220
     atgacggcgc tggccgaacg cttcgtcacc ctgctcgaga ccatcaccgc cggttcggat      5280
     gcgaaggtcg gcgacatcga cctgatcggc gcggacgaga cccaccggat gctcgagcag      5340
     tggatcgaca ccgatgtcgc cgtgccggac tcggcgaccc tggtcagcct gttcgaggcg      5400
     caggtggccc ggaccccgga cgccgtggcc gtcgtgttcg ccgaagagga actgctgtac      5460
     gcggaattcg atgcccgcgc caaccggctg gcacgcgaac tcctcgcccg cggcgtcgga      5520
     cccgaatccc gggtcgccgt cgccctgcgc cgttcactcg agctgatgat cgcgatctac      5580
     gcggtcgaga agaccggggc agcgtacgtt ccgctcgacc ccgaccaccc cgcctcgcga      5640
     atcgcctacg tgatcgagag tgccgagccc gcatgcgttc tcacctcctc ccgcgaccgg      5700
     tgcgagggcg tcgacagcgc ggcgggtgcg gcggtgatcg agatcgacac cctgaacctg      5760
     tcccggcggc cgagcacccc gatcaccgcc gccgagcggg gcggtccgat ccaccccgat      5820
     tcgaccgcct acgtgatcta cacctccgga tcgaccggca ggcccaaggg ggtcgccgtc      5880
     agccaccgcg cgatcgtgaa ccggttgctg tggatgcagg acacgtaccg gatggaccac      5940
     acagacgtcg tgctgcagaa gacgcccgtc acgttcgacg tgtccgtgtg ggaactgttc      6000
     tggcccctcg aggtcggtgc tcgactcgtc ctcgccgcgc cggacggtca ccgcgacccg      6060
     acctacctgt cccacatcat cgccgaccac caggtcacca ccatgcactt cgtgccgtcg      6120
     atgctcgcgg tgttcacggc gggcgccgaa ccggaactgt gcggttcgct ccgccaggtg      6180
     ttctgcagtg gtgaggcgct cccgcccgcc accgccgatg cgttccggga attcgggtcc      6240
     gcggcgctgc acaacctgta cggcccgacg gaagcggcgg tcgacgtcac ctactgggag      6300
     tgcacggaag gcgaccgggc ctcggtcccg atcggggcac ccgtgtggaa cacgcaggtg      6360
     tacgtcctcg actcccggct gcaccccgtg ccggtcgggg tgcacggcga gctgtacctg      6420
     gccggcatcc agctggcccg cggctacgtc ggccgcagcg atctgacgtc cgaccggttc      6480
     gtggcgaacc cgttcggcgc gccgggacag cggatgtacc gcaccggcga cgtcgtccgc      6540
     tggcgtgccg acggcaacat cgagtacatc ggccgccgcg acttccaggt caagctccgc      6600
     ggtcagcgca tcgaactcgg cgaggtcgag gcggcggtgc tggcgcaccc gtcggtggcg      6660
     caggcggtcg tgaccgtgca ccgcagcgag gccaccggcg aaagcctcgt cggctacgtg      6720
     attcccgtgg ccggcgccga catcgacacc gccgtcgtgc gcgacgcggc ggcggaggcg      6780
     ctgcccgcct acatggtgcc gacccggatc atcgtgctcg accggttccc gctcggcgcc      6840
     accggcaagc tggaccgggg tgccctgccc gagccggagt tcctcagccc gtccgccgaa      6900
     ttcgtcactc cgcggaaccc gatcgaggaa atcctcgcgt cgatcttcgc ggatctgctc      6960
     gacgcgcccc ggatcggtgt gtacgacagc ttcttcgacc tcggcggcaa ctcactggtg      7020
     gccacccggc tggtcgcgcg ggtgaacgcc gcgctgggca gccggatcgg ggtcagggag      7080
     atcttcgacg ccccgaccgt cgcgacgctg gccacccgga tcgaatccga ggccgtgcag      7140
     ggcgccgaac ggccgccgct ggtggccggg gcgcgccccg atcgactgcc ggtctcgctg      7200
     gcgcagaagc gcatgtggtt catcaaccag ttcgacctcg actccccggc ctacaacatc      7260
     gccctcgcgg tgcggttgac gggcgacctc gacgaggacg cgatgcagga cgccgtcgcc      7320
     gacgtgatgg accggcacga gtcgctgcgc acccggttcc cgatggtgga gggcgaaccc      7380
     gtccaggtga tcctgccgac cgaggacgtg gtgcccgacc tgtcgccgat agcgacgacg      7440
     gaagcggaac tgcccgagca catctcgcga ctggcgggcg ccgggttcga cgtcaccgtg      7500
     tcggtgccgg tgcgcgccgc cctgttccgt accgatcccg gcgagcacgt gctcgtgatc      7560
     gtcgtccacc acatcagcgc cgacggcttc tccatggccc cgctcgcccg ggacgtgatg      7620
     accgcctacg cggcccgcac cgggggacag gcaccggact ggacgccgct gccggtgcag      7680
     tacgccgact tcgcgctctg gcagcaccgg gtgctcggca acgccgacga ccccgacagc      7740
     ctgctggccg cgcagctcga ctactggacg cacacgctcg ccgggcttcc ggaactcctc      7800
     gcgctgccga cggaccaccc ccggccgacg cagcagtcga tgcgcggcgg gatccactcg      7860
     ttcagcatcg acccgcaggt gcacagccgg ttgatcacga ctgcccgcga acacaattcg      7920
     agtgtgttca tggccgtgca cgcggcgctc gccgtgctgc tggcccggct gggcgacacg      7980
     gacgacgtgt cagtgggcac gcccatcgcc ggtcgtggcg acgccgccct ggacgacatg      8040
     gtcggcatgt tcgtcaacac cctggtgctg cgcaccccgg tcgagccggc cggcacgttc      8100
     accgacctgc tgtccacggt ccgcgacacc gacctgaacg ccttccacca cgcggatctg      8160
     ccgttcgagc ggctggtcga cgcgatctca cccgaacgcg cgacgtcgca ttcgccgctg      8220
     ttccaggtgg tgctcgagtt ccgcaacaac gagcgcccgc ggctggagct gcccgggttg      8280
     accgtcaccg gcctcgacct ggccaccgac atctccaact tcgacctgca actcaccctc      8340
     accgaggaat tcggggcgtc gggggagccg gcggggatct ccgcggcctt cacgtacgcg      8400
     tcgagcctgt tcgacgcgtc cacgatcgcc ggcttcgccg actacctgca gcggatcttc      8460
     gacgcggtga cgtccgagcc ggggatggcc gtcggtgaca tcgacctgat ggtggcgtcc      8520
     gaacgtgcgg cgctcacccc ggtgatggac ggacccgacg ccgaacctcg gaccctgccc      8580
     gaactgctcg cggccgcggc ctccgtggac cccaaggcgg ccgcgctgtc ctacgagggc      8640
     cgtgaggtga cgtaccgcga tctcgacgag cggtcgaacc ggctcgcccg cttgctgatc      8700
     gggcgtggca tcggcccgga atcggtggtg gcgctggcgt tggcgcgctc gccggagtcg      8760
     gtgctgtcgc tgtgggcggt cgccaagacc ggtgccgcgt tcgtcccggt cgacccgaac      8820
     tacccgaccg accggatcgt ccacatgctc agcgactccg gtgcggcgct cgcgctcacc      8880
     gtcgccgagt tccgtcccac gctgccggac tgcacgtcct acgtcgtggt cgacgcaccc      8940
     ggattcgacg acgaggtgag cgcgcactcc gccgcggtcg tcaccgacgc cgaccggaca      9000
     cacccgctcg cgctggagaa cccggcctac ctgatctata cgtccgggtc caccggcacc      9060
     ccgaagggtg tcgtcgtcac ccaccgcggc ctggcgaact tcgccaccga cgaacgcgtc      9120
     cgcttcgggg tcaccccgcg gtcgcgcacg ctgcacttct cgtcgccgag cttcgacgcg      9180
     tcgatcctgg aactgctgct cgcggtcggc tccggcgcga ccatggtgat cgctccggcg      9240
     tccgtcatcg gcggcaccga actcgccgac gtgctccggg aaggccgggt cacgcacgcg      9300
     ttcatcaccc cggcggccat ggcgtccgtg gaccccgcgg gcctcgacca gctcgagtgc      9360
     gtcgccaccg gcggcgacgt gtgcccgccg gagctggtgg cgcagtgggt gaccgggggc      9420
     aggcggatgt tcaacgccta cggccccacc gaggcgacgg tcgtgtcgag cgtgacggga      9480
     ccgatgattc ccggtgaggg cgtcaccatc ggccgtccgc cgatgggaac cggggagatg      9540
     gtgctcgatt cacgcctgca cccggtgccc aacggggtga ccggcgaact gtacgtcagc      9600
     ggttccggtc tggcccgcgg ctacaaggac cgggcgggaa cgacggcgga gcgtttcgtc      9660
     gccaacccgt acgggggtct cggggcccgc atgtaccgga ccggcgacct ggcgcgctgg      9720
     aacggtgccg gccagctcga gtacctgggc cgcagcgact tccaggtgaa gatccgcggt      9780
     ttccgcatcg aactcggcga gatcgagacc gccctcacgc gttacccggg ggtcgcccgt      9840
     tcggtggtgt ccgcgcacag gggcagcacc ggagcgaacc ggctcgtcgg gtacctcgtc      9900
     cccacggcgg gcgcggaact cgacccggag gccgtcctcg aattcgtcgg cggattcctc      9960
     gccccgtaca tggtgccgtc cgcgctgatc gtcctcgacg agttgccact cacccccgca     10020
     ggcaagctgg atcgccgtgc gctgcccgaa cccgacttcg gcgcccgggt gtcgaccggc     10080
     cgcgcgccgg tgtcggagat ggaggaggtg ctcgccggac tgttcgccga ggtcctcggt     10140
     ctggaatcgg ccggtgtcga ggactcgttc ttcgccctcg gcggcgacag catcatgtcg     10200
     atccagttgg tggcccgcgc gaaggcggcg ggtgtggtgc tgaccccgcg ggacgtgttc     10260
     gaggccaaga ccgttgccgg tctcgccgcg gtggcgtcgt gggtgggtgc cgccgacgtc     10320
     gtcgtcctcg acgaactgcc cggtggcgga gtcggcgaca tgccgaccac cccgatcacg     10380
     aagtggctgc tcgaacgggg cggcgagttc aaccgcatgt cgcagtcggc gctgctgacc     10440
     gcaccgccga acctgcgcga actcgaaccc ctgagcgcca cgttccaggc cgtactcgac     10500
     cggcacgaca tgctgcgcgc gcagctgatc gtctccgccg aggactcgca cctcgccgtc     10560
     cgcccggtcg gcgaggtcga cgcccaggac ctgatccgcc gggtccccgt gtccaccgcc     10620
     ccgggaaccc gggcattcgc ggcgacggtg atcgcggaac tcgacgccgc gctggaccgg     10680
     ctcgatcccg cggccggtgt catggtgcag gtggtgtggt tcgatgccgg ggaatccggc     10740
     ggccgcctgc tcgtcgtcgc gcatcacctc gtcgtcgacg gtgtgtcgtg gcgcatcctc     10800
     gtccccgacc tcgcgaccgc ctgggcgcag atctcggcag gccaggaacc ggttctcgaa     10860
     caggtcggca cgtccatgcg ccggtgggcg cacggactgg tcgacgaggc cgcgagccgg     10920
     gcaggcgaac tggacctgtg gcagcgcatc ctcgactgcg aggacccgct cgtcggcagc     10980
     cgcccgctcg accccgacat cgacgtcaac gcgaccgtcg gccgcgtcac ggtgcagctg     11040
     cccgccgagg tcagcgaggc cgtcctcacg gccctgccgg aggccatcca cggcagcgtg     11100
     aacgacggac tgctcaccgc gctggcgatg gcggtcaccc agtggcggcg cacccgcggc     11160
     cacaccctgc acggcaggtc cgtcgacggg accctggtga gcctcgaggg tcacggccgt     11220
     gaagaccagg tcgtgccggg cgccgatctg ggccgcaccg tcggctggtt cacggccatg     11280
     ttcccggtgc gtctcgacct gtcgggcatc gacctcgacg atgcgttcga cggcggcaag     11340
     gccgccggct ccgcgatcaa ggcgatcaag gaacaactcc tcgcgatccc ggaccacggc     11400
     atgggttacg gcatgctgcg gtacctcaac gccgacaccg ccccgctgct cgcggcccgt     11460
     tcgctgccgc agatcagttt caactacctg ggacgcttcg ccgccgacct gtccgaggcg     11520
     gccacccgcg ccggctggac gccgaccggt gaagtcgaca tggaccgtgc gcaggacctc     11580
     gacaccccgg tcacctcggc catcgacgtc aacgcggtca ccaccgaggt ggaggaccgg     11640
     cctcagctgc gcgccacctg ggcgtacgcg gccggtgtcc tgaccgtcgc cgaggtccgg     11700
     gaactcgccg aactgtgggt ccgggcgctc accgcgctca cgacgtacgc ggcccgcccc     11760
     gacgccggcg gcgtgacacc gtccgacctc gaactggtca gcctcgacca ggacgccatc     11820
     gaccgcatcg aatcgcgctt cccggcgctg tccgacatct ggtcgctgtc gccgctgcag     11880
     tccggactgc tgttccacgc actgctggcc gatcagacga tcgactcgta cacggtgcag     11940
     gtgactctcg aactgcgcgg tgccgtgccg tcccgcatgc gggtggccgg gcaggccctg     12000
     ctcgaccggc acgcgaacct gcgcgcgtcg ttcgtctacg acgagggcgg caccccggtc     12060
     caggcgatcc acgggtccgc ggagctgccc tggacggaga tcgacctgtc cgggctggac     12120
     gcggagagcc gcgaggccga gatcgtgcga ctcctcgacg ccgaccggcg ccgcgggttc     12180
     gacatggcca ccccgccgct gttgcggttc atgctgatcc agatcggtgg ggacgagcag     12240
     cgcctgatca tcaccaacca ccacatcctg ctcgacggct ggtcgatgcc gctgctgatc     12300
     cgcgacctcc tgaccctgta cgccacggag ggtgacgcca cggcgctgcc gcgggtgcac     12360
     ccgtaccgcg actacctcgc gtggatgtcg caccgcagca ccgaggactc cctcggtgtg     12420
     tggcagcgcg ccctcgccgg ggtggaggag ccgacgctgc tcgcgcctgc cgacgcgtcg     12480
     gtgcagagcg acacacagtc cagcgaactg ctcgtcgaac tcgacgtcga ccgcaccgat     12540
     cagctgagtg tgctcgcacg cgagcacggc ctgaccctca gcaccctgat ccgcaccgcg     12600
     tggggaatcg tgctgggcgg cttggtcggc cgctccgatg tggtcttcgg tgggacggtg     12660
     tccggtcggc ctccgcagat cgcggggatc gagtcgatgg tgggcctgtt catcaacacc     12720
     ctgccggtgc gcgtggttct cgacccgcgg gaaacgctgg gggagttgct cgaacgcatc     12780
     cagggcgagc aagctgcgct gctcgaccac cactacgtcg gattgacgga catccagtcg     12840
     gtggccggtc ccggtgccgg tttcgacacg ctgaccgtgt tcgagtcgta tcccgtcgat     12900
     cgggaggggc tgaccgacca gaccgacatc gccggcatgc acgtcctcga cgtgcacgac     12960
     agcgcgaacg ccgcccacta tccgctggcg ctgatcgcct cggcgcacga gaacctgcag     13020
     cttaagctcg agtacgtcga ggagctgttc gaccgggccg acgtggagcg gatcggcgac     13080
     cggatcgtcc gggcgctgat cgcgctcgcc gagcaccccg ggatgaaact ggcgcagctg     13140
     cggctgctca ccgacgtcga ggaggccgaa ctggttccgg cccgcggcct gcccggccgc     13200
     tccgtgcgga cactgccgca gatgttcgcc gagacggccg ccgcggcggg tgacgcgacc     13260
     gcactcgtgt tcggggaccg ccggatgtcc taccgggaac tcgacgaacg gtccaaccag     13320
     ctcgcgcgtc tgctcatcga ccgcggcgtc ggcccggaag acatcgtggc cctgggtatc     13380
     tcacggtcca tcgaatcggt cctggcggtc tggtcgatca ccaagaccgg cgcggcgttc     13440
     gttccggtcg atccgaccta cccgcgtgag cgggtcgagc acatggtcac ggattccggg     13500
     tgcacgttcg gtctccgcct ggaggccgac cacggccggc tccccgacac ggtcaggtgg     13560
     ctgaccctgg acgacaccga gaccgcgacg gccatccggg ccatgtccac cgacaccgtc     13620
     accgacgacg accgcgtcgc gcccctgcgg ttcgcacacc cggcgtacgt catctacacg     13680
     tccggctcga ccggcaagcc gaagggcgtg gtggtcagcc accgcggtct cgacaatttc     13740
     gccgaggagc agcggacccg ctatgcgacg gattccacgt cgcgggcgtt gcacttctcc     13800
     tcaccgagct tcgacgcctc ggtcctcgaa tacctgctgt cgttcgccgt cggcgcgacc     13860
     atggtgatcg tgccgccgtc cgtgtacggc ggcgaggaac tcgcggagtt gatccgcacc     13920
     gagggcgtca cccacgggtt cgtcaccccc gcggccctgg cctcggtgga ccccgagggg     13980
     ctcgaggtgt tccagaacgt ggtcgccggc ggcgaggccg tcccgccgga actggtgacc     14040
     cgctgggcgc cgggccgcac catgtacaac ggctacggtc ccaccgagac caccatcatg     14100
     agcaacctca gcgaccacct gcaggtgggg gagacggtca ccatcggtgc ccccgtccgc     14160
     ggcgtctccg aggtgattct cgactcgcgg ctgcaaccgg tctccgtcgg cgtcgccggc     14220
     gagctctaca tctccggtga gggcctggcc cgcggctatc atgcacgcgc cgggctgacc     14280
     agcgagcggt tcgtcgccaa cccctacggc gagccgggcg accggatgta ccgcaccggc     14340
     gacctcgcgc ggtggcggtc cgatcacacg gtcgaatacc tgggccgcac cgacttccag     14400
     gtgaagatcc gcggcttccg catcgagctc ggcgacatcg acagcgcact cgccgcgcac     14460
     ccgtccgtgg cgttcgccgt caccctcggg cgccccggtc ccgccggcga caccgtgctc     14520
     gtgtcctacg tgctgccgga ggccgagtcg gcactcgaac cgccggaact gaaggagtgg     14580
     acggcgaacc tgctgcccgc acacatggtg ccgtcgagca tcatgatcct ggacgagatc     14640
     ccgctcaccc ccgtcggcaa gctcgatcgg gcggcgctgc ccgaaccgca gttcctgccc     14700
     acgtcggacg acttccggcc gccgtcgacg gtcctcgaac acacgatcgc cgacgtcatc     14760
     accacggtcc tgggcatcga acgtgtcggc atcgacgaca acttcttcga catcggcgga     14820
     aactcgctga tcgcgacccg tgtcgccgca cgcctgaccg cggaactgga caccgacatc     14880
     ggcgtccgca ccctgttcga ggcgccgacg atccatcaac tggcccgcct catcgagtcg     14940
     acggcattcg cacccgcgca ggacggcgcc cacgtccgga tcccgctcgg cccgatgccg     15000
     cggcccgcgc acgtgccggt gtccctggcg cagaagagga tgtggttcct caaccagttc     15060
     gacacgtcgt cggcggccta caacatcccc cttgccgtgc ggctgaccgg tcatctggac     15120
     gtggagtcgc tgcgcgccgc ggtgacggac gtcttcgtcc gccacgaatc gttgcggacc     15180
     gtgttcccgt ctcacgacgg cgaaccgacc caggtggtcc tctcaccggg tcagtggacg     15240
     ccgaacctcg agatcgtcga ggtgtccgag gacgaactga gggagcacat cgccggtctc     15300
     gcgacggcag gcttcgacgt gacggccgac gtgccgatgc ggtcggcgct gttcgcactc     15360
     gcccccgacg accacgtgct cgtcatcgtg gtgcaccaca tctgcgccga cgggttctcg     15420
     ctcaccccgc tcgcccggga cgtcatgacc gcgtacgccg cccgcatcgc gggaagcgca     15480
     ccacagtgga acccgctgtc ggtgcagtac gccgactaca ccctgtggca gctccaactg     15540
     ctgggcgacg aaagcgacgc cgaatcgctg atctcccagc aactccggta ctggaccgat     15600
     cagctggccg acctgcccga actcctgcag ttgcccaccg accgggcgcg gccggtccag     15660
     cagtcgttcc gcggtgcgca ggtcgacttc acgattccgg cggacgtgca ccgggcgctg     15720
     gcggcgttgg cgcgcaagca caactccacc atgttcatgg ccgtccacgc ggccctgtcg     15780
     gtgctgctgt ccgcgctctc gtccaccgag gacatcgcgg tcggcacacc catcgccggc     15840
     cgcggtgacg cggcgctcga cgacatggtc ggcatgttcg tcaacaccct ggtgctgcgg     15900
     agcgccgtcg acccggcggc aggtttcggc gccctgatgg atcaggtccg gtccaccgac     15960
     ctggccgcgt tccaccattc ggacctgccg ttcgagcggc tcgtcgacgt tctcgcgccg     16020
     gagcgctcca ccgcgcactc gccgctgttc caggcgctgc tcgagttccg gaacaacgag     16080
     acaccgcggc tcgagctccc ggaactgacc gcggccgccg tcgatttcga tctcgaggtc     16140
     gccaagttcg acctgcagct cagtgtcgag gaaggattcg acgcggacgg ggtggcgtcg     16200
     ggtatcgccg cgtcgttcat ctttgccacc gatctgttcg acgccggcac cgtccggacg     16260
     ttcgccgacc ggttcctgcg catcctcggc gccgtcacct ccgacccgct ggccccggtc     16320
     ggggacatcg tgatcaccga tgccgccgag cggtcggcga tggcgaccga atggaacacc     16380
     gccggattcg acgcgggcac cgacaccctc gcggaccggt tcgcgcagag cgtggcccgg     16440
     ttccccgacg ccacggccgt gacgtcggag gacgtggcac tgacgtacgc ggagctcgac     16500
     gcccggtcga accggctggc ccgcctgctc atctcccagg gagtggggcc ggaaacgctg     16560
     gtggccgtgg cacttccacg cacttgcgat ctgatcatcg ccctgctggc ggtgatcaaa     16620
     accggcggcg gctacctgcc cgtcgacatc acctacccgg cggaccggct ggcgttcgtg     16680
     ttcgaggacg ccgcaccgaa ctgtgtcatc accaccacgg gagacgtctc cgccctgccg     16740
     gattcggaga ccccggcgat cctgctcgac gaccccgaga ccaccgccga cctcgcgcag     16800
     cagtcgccgg cgacgatcac cgacgccgac cgggtgacgc cgctcgactc ctcgtcggtg     16860
     gcgtacgtca tctacacctc cgggtcgacg ggccgtccca agggcgtggt cgtctcgcac     16920
     cgcaacgtgc tgacactgtt cgcgaacacg cagccgctct acgggttcga cgagaacgac     16980
     gtgtggacga tgttccactc gtacgcgttc gacttctccg tgtgggagct gtggggtccg     17040
     ctgctctacg gcggccgact cgtcgtcgtc gactactaca cggcgcggtc gccggaaatg     17100
     ttccatgaac tcctgcggaa cgagcaggtc accgtcctca accagacccc gaccgcgttc     17160
     tatcagctcg ccgagaccga ccgaatcgtc tcggagatcg acgtgaacgc ggcggcgctc     17220
     gcgctgcggt acgtgatctt cggtggtgag gctctcgacc tcggacagct cggccgctgg     17280
     tactcgcggc acgacgactc cgccccgacg ctggtgaaca tgtacggcat caccgagacg     17340
     acggtccacg tcagctacct cgcgctcgac cgcgaattcg ccgagtccgc gtcggccagt     17400
     gtgatcggcc gcggaatcgc cgggctgcac gtccacgtcc tcgaccggcg cctgcacccg     17460
     gttcccccgg gcaccatcgg ggaaatgtac gtctccggtg accaggtgac ccgcggctac     17520
     ctcggccggg ccgggctcag ttcgagccgg ttcgtggccg acccgctccg tcccggggcc     17580
     cggatgtacc gcacgggcga cctggcgcgc tggaacaccg acggccagct cgagtacctg     17640
     ggccgcagcg acttccaggt gaagatccgc ggtttccgca tcgaactcgg cgagatcgaa     17700
     tccgcgctgc tccggtaccg cggcatcgcc caggccgtcg tcctcacccg cgacgacggg     17760
     cacggcggtc accggctgat cggctacgtg gttccggaat ccggcgccac cgtcgaggtg     17820
     tcgtcggcgc tcgaattcgt gggcacccag ctcacctcgt acatggtgcc cgccaccctc     17880
     gtggtgctgg acgcgctgcc gttgacgagc aacggcaaac tcgaccgccg cgcgctgccg     17940
     gaacccgact tcggggcccg ggtgtcggcg ggccgcgccc cggccacgga gatggaaacc     18000
     gtcctcgccg gtctgttcgc cgaggtgctc ggtctggaat cggtgggtgt ggacgactcg     18060
     ttcttcgcgc tcggcggcga cagcatcatg tcgatccagt tggtggcccg ggcgaaggcc     18120
     gccggtgtgg tgctcacccc gcgggacgtg ttcgaggcca aaaccgttgc cgcgctggcc     18180
     gaggccgcct cctgggcggg tgccgccgac gtcgtcgtcc tcgacgaact gccgggtggc     18240
     gggatcggcg agatgccggt caccccgatc accgcgtggc tgctcgaacg cggcggcgac     18300
     ttccgccgct acacccagac cgcgctgctc tccctgcccg ccgcggccga cgagacgctg     18360
     ctgaagcgca cgatcgcggc cgtcgtggat caccacgaca tgctgcgggc ccgtctcctc     18420
     ggcgccgagc cgcagtggcg gatcgaggtg caggccgtgg gcgtggtcga cgtcgacgac     18480
     gtgctgcacc gcgtcgaggt cgcgtcggtg gtcggttccg ggttcgcgga ggtcgcgacc     18540
     cgtgaactcg acgccgcggc aggacgactg gaccccgagg ccggggtcat gctgcagatg     18600
     gtgtggttcg acgcgggcga tcagggcggg cggctgctgg tcgtggccca ccacctggtg     18660
     gtcgacggtg tgtcgtggcg gatcctcgtc cccgacctgg cgaccgcgtg ggcgcaagtc     18720
     tccgcgggtc aggaaccgac cctcgaaccg gtcggcacgt cgatgcggcg ctggtcgcac     18780
     ggcctcgtcg aggcgacgcg cgaacgcgcc ggcgagatcg aactgtggcg gcgggtgctc     18840
     gaggccgacg acccgctcat cggatcgcgt ccgctcgacg cggcgatcga cgtggccggg     18900
     accgtcgaga aggtcaccgt ggaggtgccc gccgacgtca cggacgccct gctcacccgt     18960
     gtccccgagg cgttccacgg cggcgtcaac gacggactgc tcaccgcgct ggcgctggcg     19020
     ctggcccagt ggcggcgcac ccacggcgac ttcacgcgcg aatcgctggt cagtctcgaa     19080
     ggccacggcc gcgaggacca ggtgctgccg ggcgccgatc tgggccgcac cgtcggctgg     19140
     ttcacggcga tgttcccggt gcgtctggac ctgtcgggga tcgacctcga cgacgcgttc     19200
     gccggtggca aggccaccgg gtccgcggtc aaggcgatca aggaacagct gctggccatt     19260
     ccggaccacg gcatcggcta cggcatgctc cgctacctgg acccggagag cgcggatcag     19320
     ctgcgggcgc tggcgaagcc gcaggtcacg ttcaactacc tgggccggct gggcggcgcg     19380
     acgtccaccg acatccacgg tcacgcctgg gttccggtga cggacacgaa gctcgacgac     19440
     atccccgcct ccgacatccc ggtggcgtcg gcgctcgaca tcaatgccgt caccggcacc     19500
     ggggccgacg gcaaccggct gcgggccacc tgggcgttcc cgaccggggt cctcaccccg     19560
     tccgaggtcc gcgcactcgc cgacctgtgg gtgcaggcgc tgaccgcgct gaccacccac     19620
     gtcgcacggc ccgacgccgg cggtgtgacc ccgtccgatc tggacctggt caccctcgac     19680
     caggacgcga tcgaccggct cgaggcccgg ttcccggcgc tgtcggacat ctggtcgctg     19740
     tcaccgctgc agtccgggct gctgttccac gcccagttct cggacgcctc ggtcgacccg     19800
     tacctggtgc agctggcgct gaaactgcgc ggcaacatcg acccggaccg gatccgccgg     19860
     gccgggcagg ccctgctgga ccggcacccc aacctgcggg ccgcgttcgt ccacgacagc     19920
     gcgggcgcct ccgcgcaaat catccagcag cacgtggaac tgccgtggtc ggagttcgac     19980
     ctctcggcac tcgacccgga cgagaccacc cgcgaatacg accggatcgt tgcacgggac     20040
     cggtcggtga agttcgacat ggcgaacgcg ccgctgctgc ggcttgccct cgtccggctc     20100
     accgaggagg actaccggct gatcctgacc aaccaccaca tcctgctcga cggctggtcg     20160
     actccgctgg tcattcgcga cctgctgacg ctgtacgcgt tggacgccga cggcagcctg     20220
     ctgccccggg tccactccta ccgcgactac ctgtcgtgga tgaagcggca cgacaccacg     20280
     gactccctcg acgcctggcg caccgcgctc gacggtgtcg aggagccgac cctcctcgcg     20340
     ccgctggagc ggggtgaagc gcactccgcc gtggcggagg aaaccgcctt cacgctgtcg     20400
     gaggagcaga ccacccggtt gcgggacctg agccgggaac gcgggctcac cctcaacacc     20460
     gtcgtccaga cggcgtgggg aatcgtgctg ggcggcttgg tcggccgctc cgacgtggtg     20520
     ttcggtggga cggtttcggg ccggccgccg cagatcgcgg gcatcgaatc gatggtgggt     20580
     ctgttcatca acaccctgcc ggtgcgggtg accctcgacc cgtgggagtc gctgggcgag     20640
     ctgctcgaac gtgtgcagag cgaacaggcc gcactgctcg atcaccacta cgtgggtctg     20700
     accgacatcc agtcggcggt cggcggcggc ggtgccttcg acacgctgac cgtgttcgag     20760
     tcgtacccgg tggacgaggc ggggctgacg gaacagaccg acatcgccgg gatgttcgtc     20820
     accggcatcg acggcaagga ctccgcgcac tacccgctcg ccgtcgtcgc ctccggggac     20880
     gcgcggctga acttcaagtt cgagtacctc cccgaggtat tcgaggaaag cgcggtcgac     20940
     gagatcgcgg accggctgca gcgggtgctc gacgccctcg cggaccggcc cgagattccg     21000
     ctcgcccaca tgcaactgct caccgaggcc gaactcgccg agttcgcgcc ggtgcgcggc     21060
     cgccccgggt tctccgtccg gacgctgccg cagatcttcg aggacgccgc cgccctggat     21120
     ccgaaccgca cggcgctgac gttcgagggc cgcaacgtct cctaccggga actcaacgaa     21180
     cgctccaacc agctcgcccg ggtgctcatc tcccgcggcg ccggcccgga gacgttcgtg     21240
     gcgctcggca ttccccgatc gatcgagtcg gtcctcgccg tgtgggcagt ggccaagacg     21300
     ggcgccgcat tcgtccccgt cgacccgaac tacccgatgg accgcatcga gcacatgctc     21360
     accgattcgg gtgccaccat cggactgacc atggccgcgt acgagaaggc gctgcccgac     21420
     tcggtgccgt ggctgcagct cgactcgccc aagttcgaga aggcctgcca gtcgaaaccg     21480
     gctctgccgg tagccgattc ggatcggcgg tcgccgataa gcctcgacaa cgccgcctac     21540
     atcgtctaca cctccggttc gacggggaag ccgaagggcg tcgtggtcac ccacgagggc     21600
     ctcgacaact tcgccgagga ccagcggcag cgtttcgccg cggcacagac gtcccgcacc     21660
     ctgcacttct cgacgcccag cttcgacggg tcggtgttcg agtacctgca ggccttcggg     21720
     gtcggtgcga cgatggtgat cgcaccgccg acggtgtacg gcggagcgga actggccgaa     21780
     ctgatcaggt ccgaacacgt cacccacgcg ttcgtcacca ccgcggcgct gtccacggtc     21840
     gacccgacgg ggctcgacga attccagcac gtcgtgttcg gcggcgaggc gtgcccgccg     21900
     gaactggtga cccgctgggc gcccggccgg caactgtcca acgcgtacgg ccccaccgag     21960
     accacggtga tggccaacat cagcgacccg atgacggtgg gcgaccccat caccctcggc     22020
     ggcccgatcc gcggcgtcgg tgagctcgtg ctggattcac gtctccagcc ggtgcccgtc     22080
     ggagttcccg gcgagctgta catcaccggt gccgggctcg cccgcggcta ccaccggcgc     22140
     ccggaactga gcagccagcg gttcgtcgcc aacccgttcg gggaggcggg ggagcggatg     22200
     taccgcaccg gcgacatcgt ccggtggcgc gccgaccaca ccgtcgagta cgtgggccgc     22260
     agcgacttcc aggtgaagat ccgcggtttc cgcatcgaac tcggcgagat cgacaacgag     22320
     atcgccacgt tccccggggt cagcttcgcc gcgaccctcg gtgttcccgg cccgtccggg     22380
     gacacggtgc tggtgaccta cctgctgccc aacacggccg gcggcgtcga tccggccgaa     22440
     ctgaccgcgc acctgtcgac ccggctcccc gcgcacatgg tgccgacgag cgtcatgttc     22500
     ctggacgaga tcccgttgac cccggtgggc aaactggacc ggtcggcgct gcccgcaccc     22560
     gagttccacg tcaccaccac cgagttccag ccgccgacca acgatctcga acgcaagatc     22620
     gtggacatct tcgccgatgt cctcggtatc gaacggatcg gcatcgacga caacttcttc     22680
     gatctcggtg gaaactcgct ggtcgccacc cgggtcacgg cgcggttgcg ggacgccctc     22740
     gacaccgaca tcggtgtgcg cgccctgttc gaggcccccg acgtccggtc gctggccgca     22800
     cgcgtcgccg acagtgtgag cggcggtgcc cgcccggccc tcgcgccggt cgaacggccc     22860
     gaccggattc cgctgtcgct ggcgcagaag cggatgtggt tcctcaacca gttcgacacg     22920
     tcctcaccgg cctacaacat tccgttggcc gtcaggctga ccggaaccct ggacgaggac     22980
     gccctgcggc tggcgatggc cgacgtactc gaacggcacg agacgctgcg caccgtcttc     23040
     ccgacggtcg acaacgaacc gacccagcgg atcctgcccg ccgccgatgc gcaaccgggc     23100
     gtcgacaccg tctcggtggc ggcggaggac ctgccgcggc acatcatgga cctggtgtcc     23160
     cgcgggttcg acgtcagcac cgacgtgccg gtccgggcgg ccctgttccg gatcgcgccc     23220
     gaccatcacg tgctgacgat cgtggtgcac cacatcagcg cggacggatt ctccctcgcg     23280
     ccgctcgccc gcgacgtcat ggtggcgtac acgtcacggc tcggcggcga cggcccgcag     23340
     tgggatccgc tgcacgtcca gtacgccgac tacacgctgt ggcagcatgc cggactcggc     23400
     tcggagaacg atcccgaatc gatgatcaac cagcagttgc ggttctggtc cgagaccctg     23460
     gccggggtgc cggacgtcat ccagctgccg accgaccggc cgcgcccgat ccagcagacg     23520
     ttcgagggtg atcgggtcga attcgcgatc gacgccgacc tccatcagcg gctcacggca     23580
     ctggcccggg ccaacaacgc caccatgttc atggccgtcc acgccgcgct ggcggtgctg     23640
     ctgtcgaggc tcggcagcac cgacgacgtc gtcatcggca cccccgtcgc cgggcgcggt     23700
     gaagccgccc tcgacgacat ggtcggcatg ttcgtcaaca ccctggtcct gcggaaccgg     23760
     atcgacccgg cgtcgacgtt caccgaactg gtgcagcgga tccgggaaac ggacctggcc     23820
     gcgttccagc actcggatct gccgttcgag cgcctcgtcg aggagctcaa cccgacccgg     23880
     tccacgtcgt actcgcccct gttccaggtg gccctcgagt tccagaacaa cgagaacccg     23940
     acgctggaac tgccggatct gcgggtcgag aacgtggacc tcgaaaccaa ggtggtgaaa     24000
     gaagacctcg aggtgatcct ggccgagcag ttcgaccagg acggcgcgcc cgcgggtgtc     24060
     gccggcggtc tcgacttcgc cgtctccctg ttcgaccgcg ggaccgcacg ctcgatcgcg     24120
     gaccggttcg tccggatcct cgcggctgtc accgccgatc cggaccggcc gatcggcacc     24180
     ctcccgctgc tcgacgaggc ggagatcgag gagatggtcc cggcgcgcgg caagcccgac     24240
     gtgcgccccg aggtgtggcc cgacctgctg acggccgccg cggcactcga ccccgattcg     24300
     gtggcgttgt ccttcgagga ccggcaggtc acctaccgcg aactcgacga atggtccaac     24360
     cggctggcgc gggtgctgtg cgcccaggga gtcgggccgg agacgttcgt ggccatcgga     24420
     atgccgcgat cgatcgagga agtcgtgtcg atctggtcgg tcgcgaagtc gggtgcggcg     24480
     ttcgtgcccg tcgacccgac ctacccgcgg gaccgcatcg actacatgct gaccgactgc     24540
     cgggcgtccg tcggcctgac cgtcgccggc cgtcgcgaca acctgccgga caccgtgccg     24600
     tggctggtgc tcgacgacga gtccttcgcc gagcaggtcg cggccgtctc ctcgtcgccg     24660
     gtcaccgacg ccgaccgcac gcgcccgctc catctggccc acccggcgta cctgatctac     24720
     acgtcgggat cgaccggtaa accgaagggt gtcatcgtca ctcaccgcgg catggccaac     24780
     ctcaccgcgg aggaacacga acggttccag gtcacgcacg agtcccgggt ctcgcatctg     24840
     gcgtccccga gcttcgacgc gtcgatcttc gagctgatga tggcgttcgg tgcgtcggcc     24900
     cgggtcgtga tcgtgccgcc caccgtcttc ggtggcacgg agctggcgga cctgttccgg     24960
     cgcaacgcgg tgacgcacgc gttcatcacg cccaccgcgc tgtcgtccat cgaggacgtg     25020
     ggactcgaat cgctccgcgt cctcgcggtg gccggtgagg cctgcccgcc ggagctggtg     25080
     gagatctggg gtaagcaccg caacatgcac aacgggtacg ggcccacgga gacgaccatc     25140
     caggcgagcg tcagtgctcc gatgcgtccg ggtggggtcg tgaacatcgg cgcccccgcg     25200
     ctgggattcg gttcgctggt cctcgacgag cgcctgcagc cggtcccggt cggtgtgccc     25260
     ggcgagctgt acatcaccgg acccggactg gcacgtgggt accacaaccg gtcggcgctg     25320
     acgtcggaac ggttcgtcgc ctgcccgttc ggcgagcccg gtcgccggat gtaccgcacc     25380
     ggcgacgtgg tgcgctggcg cggcgaccac accatcgagt acatcggccg caccgacttc     25440
     caggtgaagg tccgcggctt ccggatcgaa ctcggtgaga tcgacgccgt cctcgcccgc     25500
     caccccgcgg tcgcgttcgc cgccaccatc ggccacaccg gaccgtccgg cgacacgctc     25560
     ctcgcgtcgt acgtgcgggc ggcggaggga cacgatctcg agccggcgga gttgcgtacc     25620
     cacgcggccg accgcctgcc cgcgcacatg gtcccgtccg cggtggtcgt cctcgatcag     25680
     atcccgatga ccccggtcgg caaactcgac cgcaaggcgc tgcccgcgcc cgagttcggc     25740
     accaccggcg cggccttccg ggccccgacg acggcgaccg agcggatcat cgtcgaggcc     25800
     ttcgcagagg tgctgggcgt ggaccgcgtc ggcaccgccg acagtttctt cgacctcggc     25860
     ggcaactcga tcgtcgccac ccgggtgatc acggtgctgc aggaacgcct cggacggcag     25920
     attccgttgc agtccatgtt cctggacccg acccccgcgg gcctggcgct gcgggtcgac     25980
     acggagaacg cggccgggtc gccggtggac gaggcgctcg gcgtggtcat cccattgcgg     26040
     ccgacggggg acaagccgcc cctgttctgc atccatcccg ggatcggcct gtcgtggggt     26100
     tacgcgggtc tcctgcagca cctatcgcag gaccggccgg cgttcggcct gcagttgccg     26160
     atcatcagcg gtggcccgag cttcgagtcg atcgagcagc tggcgcacca gtacgtgctg     26220
     gagatgcgaa aggtccaggc gcacgggccc taccacctgc tgggctggtc gctcggcggc     26280
     gtcatcgccc acgcgatggc cgtcgaactg cggcgggaag gggaggcggt cgacacgctg     26340
     gccgtcatgg acagctacgt gaccggcggg accgaccagg gcccggagag cctcaccgtg     26400
     cccgagttgc tccacgggct cggactggac ctcgagtccg tctccgggga ggaactcacc     26460
     tacgagcggg cagtcgagtt gctggacgac gcgttcgggc agaagacggg actgaccccg     26520
     cagcacctgg agcggatcag cgccggattc accaactcgt cgcggatcat gaacaacttc     26580
     cgcccgcagg tgttcgacgg ggatctgctg ttcttcaccg ccgccggatc ggcgtcgacg     26640
     gaccagcatt caccggagga gtggcggagt tccgtcaccg gcggcatccg ggaagtgaag     26700
     atcgagtgcg agcacaatca gatgatcgaa cccgaggtcc tggccgtggt ggggcccgtc     26760
     ctcgaggact atctgagcgc gcattga                                         26787
//

If you have problems or comments...

PBIL Back to PBIL home page