(data stored in ACNUC7421 zone)

EMBL: CP000431.PE142

CP000431.PE142       Location/Qualifiers
FT   CDS_pept        complement(171523..171855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91978"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF8"
FT                   /protein_id="ABG91978.1"
FT                   /translation="MTGASRRPDSCVWCGREVAETGMGRRRRYCRQSCRQRAYEQRNQV
FT                   KGTSIPADAVVLTSEEASAMVDRVFQVRCAAEDVATAVAEGAAAHEVESLCADLVQLAR
FT                   EAERFR"
     atgaccggcg cctcccgcag acccgattcc tgtgtgtggt gcggccgcga agtggccgag        60
     acggggatgg ggcggcgccg ccggtattgc cgccaatcct gccggcagcg cgcatacgag       120
     cagcgcaacc aggtcaaggg cacgagcatc cccgccgatg cggtggtgct cacctcggag       180
     gaagcctccg ccatggtcga ccgggttttc caggttcgat gtgccgccga ggacgtggcg       240
     acagccgttg ccgaaggtgc ggcggcccat gaggtggagt ccctgtgcgc cgacctcgtg       300
     caactcgcac gtgaggccga acgcttccgc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page