(data stored in ACNUC7421 zone)

EMBL: CP000431.PE143

CP000431.PE143       Location/Qualifiers
FT   CDS_pept        171854..172366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00143"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91979"
FT                   /db_xref="GOA:Q0SKF7"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF7"
FT                   /protein_id="ABG91979.1"
FT                   /translation="MVNHLTARRLDARPVRCRGCICAACGNQSGGRGVVDECERLVLVQ
FT                   AYSRGDDRGEDTTMADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPFAD
FT                   DAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERLDLL
FT                   KAKRRGA"
     atggtcaacc accttactgc gcggcgcctc gacgcccgcc cggtaagatg tcgaggttgc        60
     atctgcgcgg cgtgcgggaa ccaatcggga ggccgtggcg ttgtagatga gtgtgaacgc       120
     ttggttctgg tccaggcgta ctcgcgcgga gacgatcgag gagaggacac aaccatggca       180
     gatcgcgtac ttcgaggaag tcgactcgga gcggtgagct acgagaccga ccgtgaccac       240
     gacctcgcgc cccgtcggat ggccaagtac cggtgcgaca acggtgaggt cttcgacatt       300
     cccttcgcgg acgatgccga gattcccggc acgtggctgt gccgcaacgg cctcgaggga       360
     accctggtcg aggggactgc gcccgaagcc aagaaggtca agccgccgcg tacccactgg       420
     gacatgctgc tcgaacgccg ttccaaggag gaactggagg agctgctgaa ggagcgcctc       480
     gacctgctga aggcgaagcg ccgcggagcc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page