(data stored in ACNUC7421 zone)

EMBL: CP000431.PE144

CP000431.PE144       Location/Qualifiers
FT   CDS_pept        complement(172901..204019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00144"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.13"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91980"
FT                   /db_xref="GOA:Q0SKF6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91980.1"
FT                   /translation="MSFRGWPVGVVPTAVVGKRTNKVVDAVPSGDVTAVDRIPDGAFPL
FT                   STAQRGMWFAQQLDPEVPVTIAQCVELVGVLDVALLSESLITAGRELGSAFLRLVEVDG
FT                   VPYQLVDPTLDASVRFVDLQREPDPRAAAKEWMRQEYTTPLDVCRDRLVTSAVLCTGPD
FT                   RHYWYSRVHHVALDGMGSMTLIDRTTQLYTAAVQGRTAAPSKAAALTDVARVDDDYRIS
FT                   PRYRADQEYWSERVSTIGETHSLVERSAPARARSRTAGGQIPGTLVDHLEAATDRHDSS
FT                   TAFEVIAAFAAYLSRMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLHLHVRPDMTN
FT                   ADLVAAVRLEVTAALRHQRYPHIDIRRDAATEHQGFYGPLINVMLFHDEITLGSIVGRL
FT                   ELLSTGPITDLAVNVYHGVAGTSLNLDFEANPDLYSEGTLRAHHTRFTRFLGAFLTSDT
FT                   DEPRRVGDLDILDDDESRTLVPASGRAGFAPVTLPDLLGGAVRSNRDGDALVAPGHGIS
FT                   SADTLSYRALDEASNRLARLLIDLQVGPEVMVALALPRSRESVSSVWAVAKAGAAFVPV
FT                   DPSLPADRIAFMLEDCGAPIGITTAALRDGLPECTHWIVLDDDEFRATAAAYPPDAVTD
FT                   TDRTRALSVDHPAYVIYTSGSTGRPKGVAVTHRGVVNLAADERDRLVVSSGSRVLHFAS
FT                   PSFDASVFELVMAVCAGATLVVAPTTIYGGTELAELMAEQRVTHAFCTPAALASLDHRG
FT                   LDHLRTVVVAGDVCPPELVARWAPGRIMVNAYGPSETTIMSSATGPMVPGQPVTVGSPT
FT                   VGVDLVVLDHRLRPVPAGVRGELYVLGSSLARGYVRRAGLTAERFVASPFGTGGRMYRT
FT                   GDVVRWVTAPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALTAHPVVEFAYTVGYDDG
FT                   SGSSRLVSYVLPVPATDVETRVLSEFVGERLPGYMVPSSIMMLDSLPLTPAGKLDRNAL
FT                   PAPVFAARSADIVRPRTVTEEILLGIFRDVLGLPELSVDTSFFELGGNSLMATQVVSRV
FT                   NTALGVRIGVRDLFQSPSVSQLAVPAANTGPQADSRPVLEARERPDHVPLSVAQQRMWF
FT                   LNQFDTASPAYNLPISLRLTGALDREALRAALGDVQERHEALRTVFPDTPDGPHQLVVP
FT                   VVSVLAETDPIDVDAKSLTAAVTALGGAGFDLTTDTPLRAGLFREAPDRHVLVLVVHHV
FT                   AADGWSMTPLAADVMVAYAARVAGHAPTWAPLPVQYADYTLWQRELLGSEDDPDSVSAR
FT                   QIAHWQSALAGVPQLLELPADRPRPAEMSHRGGRVEFTITADVHGRLVDLAQSTGTTLF
FT                   MVTHAALVVLFHRLGAGTDIVIGTPVAGRGEEALDDLVGMFVNTLVLRATAEPGDTFEE
FT                   VLDRVRDADLAAFSHADVPFERLVEVLSPDRSAARHPLFQVMLSFQNTAPTSVELPGLE
FT                   VAAAEIDVHVAKFDLQLTVTERFVGAGMPGGLAAGFDYATDLFDESTVASMAERFANLL
FT                   RSVAASSATVVGDLSLLHAAERDRLLGTWNDTAHRVPAMCLPELFDAQVARTPDAVAVV
FT                   FGDVTLSYSQLDCRANSVARYLIDRGVGPESRVGLAMRRSPDLLVGMYAIVKAGGAYVP
FT                   VDPDHPTDRIGYVLDSAQPVCVLTTSADRGALPAGQSFVEIDRIALDSYSGGPVTDSDR
FT                   LAPLRPDNPAYVIYTSGSTGRPKGVSVPHRGIVNQLLWMQSEYALTERDVLLQKTATTF
FT                   DVSLWGYFWPLHTGATMVLATPDGHRDPEYLARVIDEHGVTVTDFVPSMLDAFVASVPI
FT                   TSCSTLRHVFVIGEALPPETVTRFRALSDAGLHNLYGPTEAAVSVTYWDTATTVAGTVP
FT                   IGVPEWNTQVYVLDSRLHPVPPGVAGELYLAGEQLARGYLGRVDLTSDRFVANPFTPGL
FT                   RMYRTGDLVRWTSAGALEYIGRTDFQVKFRGQRIELGEIEFVLRAQPSVTSAAVLVHSD
FT                   PGTGDRLVAYVVPEPGHDLDTTRLRECAAASLPAYMIPAALMVVDEFPLNTSGKLDRQA
FT                   LPAPEFGGSGTEYVAPRTSVEANLAEIFAEVLGLDRIGLRDNFFDVGGNSLVATRVTSR
FT                   IRAELGAPLALRDLFDAPTVGALAERIEGTVQTTPRAPLVAATRAGRIPLSPAQRRMWF
FT                   VNQFDTASAAYNMPFALRLSGILDCDGLRSAIRDVLERHESLRTLYPDSTDGPHQVIVG
FT                   ADEVPLDLDVQPITEAELPTRLVELATEGFDVTSAVPLRTALLRLSVDEYVLAVVVHHI
FT                   SADGSSMAPLARDILLAYTARTAGRAPSWPPLDVQYADYSYWQAEFLGDETDGRSQATE
FT                   QIEFWSAALDGIPDLLELPADRPRPAMPTNSGATVPFSVDAATAKAVADLAARSAATPF
FT                   MVWHAALSVLLSRLSNAVDVTVGTPVAGRAEPSLQDLVGMFVNTLTLRARVSGDLSFAD
FT                   LLAQVREFDLAAFAHADLPFERLVEVLEPARSTARHPLFQVGLSYENFEPGVLELPGLT
FT                   VSAVEMNPEIAKFDLNVTLTEIRDERGTVSGLTGAFTYAVDLFDRDTVESFADRFARIV
FT                   TAALADPGTAVGDLPVLDQRELVRVLREWNATDVEVSGRPYLARYDEQAARTPDAVAVV
FT                   YRDVSVTYREFNSRVNRLARKLIAEGAGTETTVAVAARRSIEFLIALHAVLRSGAAYVP
FT                   LDVDLPAERVAHVIEAAHPVLVLTAVRGEFESDSGVRVLPIDGLELDRFDDAPVTNRDR
FT                   LRPLAADNLAYVIFTSGSTGRPKGVAVSHAGLGSHFEFLMSLCALDETDRVVVKTPQSF
FT                   DASLWELLWPLAVGARVVIAEPDGHKDPDYLAELIDTEQITAIHFVPSMLAVFTDVIAP
FT                   SRFSSLRTVFVGGEALSVNVARRFAAVSDAAVLNAYGPAEVAAASTTSWVDTSNSAIVT
FT                   VGTPVWNTRAYVLDQRLHPSPAGVTGELYLAGTQVSRGYAGRPDLTAERFVANPFDAPG
FT                   TRMYRTGDRLRWTGRGELEYLGRNDFQVKLRGLRIELGEIEAVLESADSVAQAVVTVYS
FT                   GAASEQLVAYLVARAGTRVDIEALTAYAASRLPEYMVPDGFVTLDAFPLNASGKLDRVA
FT                   LPAPAVGDVAVDRVEPRTPMEESLAALFREALGVDDLGVNDSFFALGGDSIVSIQLVSR
FT                   AKAAGIVFTPRDVFERKSIAALAEVVTVASADRLALAELAGGGVGNVELTPVVRSLLDR
FT                   SGSVGRYSQSVLLTLPTGIERSDIVATVQAVLDRHDALRSRLVRDGADVRHSVLPTGAV
FT                   DADRLVTTVSVNPDLGDAAFDALIDRELSAAADRFDFETPVLTQFVWLDRGATRPGRLL
FT                   VVAHHLVVDGVSWRIIVPDLVAAGGAVAAGHAPNLPEVGTSLRRWSHGLSEAARQPSTV
FT                   AQFDYWRSVVDAADPLLGGRALDPVRDRTSTTQELHVELSTEITATLLARVPEAFGCSV
FT                   GDSLLAGFAVALTEWRRARGVPAASAYITLEGHGREESVVPGADLSRTVGWFTSVYPVR
FT                   LALEGVDTQDALVGGASAGAAIKAVKEQLLAVPDRGVGYGLLRYLNPATATVLAGFDPP
FT                   QVVFNYLGKTGMGDLSPEMREIGWVPDLESSRVFSGETDQDMSASAAIEINAGVTDTDA
FT                   GPRLGASVRFAGELLAADDVRELVDLWQQALVSQIEHVVAGSGGGLTPSDIGTVALTQS
FT                   QIDLWERAYPTLEDVWALSPLQAGFHFHSLLAAEHSVDVYHSQLRMTLLGDVSADRMRA
FT                   AAAALLDRYSNLRVVFVQDGDVTAQIPLRGVEVPLTVVDLSGRESDSGERELESLVAEN
FT                   RTAPFDLSEAPLLRLLLVRTGADRHELAMTNHHILLDGWSIPLIVQDLLVLYATAGDQS
FT                   ALPAVRPYREYLDWLTRRDPSASRAAWAHALEGFDEPTLLAPAHTGGSATADPEEVPVH
FT                   FSAADTAELLAFARQHGVTPNTVIQTAWALLLRRLTGRDDVVFGATVSGRPPHIPGIES
FT                   MVGLFINTVPVRVRIDADESVAELLVRVQGQQADLLDHHYLGLTEIQAEAGVGALFDTL
FT                   TVFESYPMDQAALQAQTDIAGMRVDSVQVHSVTHYPLSLMAQVDDTLRLGVAYLPDTFE
FT                   RDEARLIAARLDSVIRALIAEPSAAVAQVTGFIPGEYARVMHDWNATGHHVPESTLLTL
FT                   FEAQAARTPDAVAVDFDGDVLTYAALDARANQLARHLIALGVAPETRVAVVMRRSLELV
FT                   VGIYAVLKAGGAYVPVDPDHPAERTSYVLASAQPVCVLTTSADRPDLPNRIPVSALDTL
FT                   DLSGVSAVPLTDAERIEPLRPAHPAYVIYTSGSTGKPKGVAVPHAAIVNQLLWMQSEYA
FT                   LTDRDVWLQKTATTFDVSLWGYFWPLQVGATMVLATPDGHREPAYLTRVIDERAVTVTD
FT                   FVPSMLDVFVAAAPEGTCRSLRLVFVIGEALPPATVLRFRELSAAGLHNLYGPTEAAVS
FT                   VTYWKTGDADTTNVPIGVPEWNTQAYVLDSRLHPVPVGVPGELYLGGAQLARGYLGRVD
FT                   LTSDRFVANPFGRTGERMYRTGDLVRWTSSGALVYIGRTDFQVKFRGQRIELGEIETVL
FT                   RSHPAVTGAVVSVYSDTTVGDHLVAYVVGTPGELDVAELRRQASESLPSYMVPSAITVL
FT                   DEFPLNTSGKLDRKELPAPEFHGSSTEYIAPRNEAERTVAAVFADVLGSSRVGAHDNFF
FT                   DLGGNSLSVTRVAARLGELSGTGLSVRDVFTAPTVAELARRLAEPTAAGGARPVLSGMQ
FT                   RPARIPLSPAQQRMWFINQFDPSSPAYNLPFAVRMSGALDVAALSQALDDVVGRHESLR
FT                   TVFPDTDDGPAQVVVSAADLSMPLEVVDVPEGELDSRMIAFSSHGFDVSEDLPVRATLF
FT                   RTGPGEHVLAITLHHIAADGWSFGPLGADVMVAYAARAESRSPEWIPLAVQYADYSVWH
FT                   RAVLGSEDEPESLARRQLEYWTRTLDGLPDELKLPFDRPRRTEQSYVGGSVGFTITPEI
FT                   HSGIERLAREHGATVFMVAHAAFALLLARLSASDDIAVGAPIAGRGERALDNLVGMFVN
FT                   TLVLRTRIESTETFAELLTRVRDGDIGAFGHADLPFERLVDVLDPVRTSAHHPVIQTAL
FT                   SMQPTAIDDIELPGLRVRVEDIDARVAKFDLQLTLGEDIDPAGVPSGIRAEFTYAADLF
FT                   DDVTVRRYAGQLVRILETVIADPTTVVGDVNLLDDAERARLAPVRGPASRPSRLLPEVL
FT                   AESAADPSATALVFGDRSMTYGELDRRSNLWARELIEAGAGPETFVAVALARSIESVLA
FT                   VWAVAKTGAAFVPVDPNYPAERIAHMLGDSGSALGLTTIEFRAGLPDSTQWLVMDDPDH
FT                   TALVTSHSSAAVTAADRLGRMHADQLAYLIYTSGSTGLPKGVAVTHSGLANLLTELADE
FT                   YELTADARTLHFASPSFDASVFEYLMAFCRGATMVVVPHSVYGGTELAELLGAQGVTHA
FT                   FFTPAALASVDHTGLDELAVIVVGGEAWGADLAERWVPGRALFNGYGPTESSMMVTQSG
FT                   PLMLGERMTIGAPVRGVEAFVLDARLHPVSPGVPGELYISGPALARGYHQRLGLTAERF
FT                   VANPHGAPGRRMYRTGDLVRWVESRTGTYVIEYVGRSDFQVKIRGFRVELGEIDSVFRA
FT                   HSAVGFAATIAHDTESGVTALVTYVCAASGNDVDVDDLTAFVGGVLPAHMVPGSIMVLD
FT                   SIPLTPAGKLDRRALPEPVFVSHTRFTAPDTADEIAVAAAFADVLGESRIGVDDNFFAL
FT                   GGNSLSATQVVSRVGSAFGTRVSVRTLFDNPTVRQLVSAVATSGPDASSGRPALTRREH
FT                   PGRIPLSLAQQRIWFLNQYDPSSSAYNIPLALRMSGRIDVPALRAALGDVLERHESLRT
FT                   VYPGSADGAHQEILPAAAAEFDLTPIRTAPDQLMLRIAEYAVAGFDVTREIPFRIHLFR
FT                   ENRSEHVLLLVAHHIAADGWSFGPLAADVMAAYASRVEGLAPSWEPLPVQYADYSVWQR
FT                   ELLGAEDDPDSLSATQIERWRAALDGAPEALDLPTDHPRPAVASHRGERVDFEIDADTH
FT                   RGLVERAQKGGTTLFMVVHAAFATLLHRLSGSTDIVIGTPVAGRGDEGLDPLVGMFVNT
FT                   LALRTRIDPGESIDALLEQVRDVDLTAFQDTEVPFDRLVEILRPTRSSDRHPLFQVMFA
FT                   FQNLRPVTMELPQLVVEAVDFDPHIAKFDLDLALAEIVDDAGHHHGISGAFTFASELFE
FT                   RATVAGFADRFLRILEAVASADDIAVGDIAILGAAEQGSLAPVWGGPLLANATLPELLV
FT                   ATAERYPDSTAVVFDGVSIDYRELDRRSTQLARALIGMGVGPETYVALALPRSVESVLC
FT                   VWAAAKTGAAYVPIDPAHPADRIAHILRDSGVVVGVTCAEFAEHLPGVTDWLVLDDPAV
FT                   LRELSSASTAPVGDADRTSALHVDHPAYLIYTSGSTGLPKGVVVSHRGLANLAGSYTTA
FT                   VRATEESRVAHLASPTFDLSVLELLLAHTSGAALVVCPPGVYGGVELHEVLQSERVTHM
FT                   TITNAALASVEPEGLDDLRSIVVGGDACPPETVARWADRLELVNGYGPTEVTVGATFSS
FT                   VLGQGRDITIGGPLPGVAAVVLDSRLRPVPVGVVGELYLLGPALARGYHERAALTAHRF
FT                   VASPFEAAGARMYRTGDIVRWRAVHSGVTGSMTDGTFPGHAIEYLGRSDHQVKVRGLRI
FT                   ELGEIDAALNAHPDVEFAATLGYESPAETRLASHVLVGAGADRDPAALLAFLRQALPGY
FT                   MVPSALVFLDTIPLTPNGKLDRDALPAPDFGAAAKEIVYREPRNPLEQSIADAFAEVLG
FT                   GTDIGLDTDFFDAGGNSLSATRVTARVGALLDIRVTVRDLFEAPTVLALAESLAPRMSE
FT                   AGDGASAGPALAPQPRPDRIPLSLAQQRMWFLNQFETSSPAYNLPAAVRLTGPLDTAAL
FT                   AAAIDDLITRHESLRTVFPDSRGGPHQVILEPGQFTPDTAPVRVSESGLRADLEQFLLT
FT                   GFDVSQAVPLRVKVYSLGDTEHVLAFVVHHIAADGVSMEPLIRDVMIAYSSRAAGHAPS
FT                   WAPLPVQYADYALWQREVLGVESDPGSLAAAQLEYWTRTLAGVPDQLYLPGDRGRPAVP
FT                   SHRGAATRFTLDADTHRALAELARAHGASIFMVAHAALSVLLGRLSTSSDITVGTAIAG
FT                   RGRVELDDIIGMFVNTLVLRTTLDPGASFVSLLEQARDVDLEAFAHADLPFERLVEVLS
FT                   PVRSTSHHPLFQVALGVQAVSADRLELDGLSLEPLTLDASTAKFDLHFTLTERLDDASE
FT                   AAGIDAELVYATDIFDESTAAEYAIRLRRIFEAVVADPQRPIGDIPVLGDEEYAALTPV
FT                   RGADARPVQMLPEILADAVAAAPDGPAVVFEGESLTYRDLDERSNQLARLLVDRGVGPE
FT                   TRVALALPRSLESVVAVWAVAKTGAAFVPVDPGYPADRVLHMVQDSGAMVGITVSAKQD
FT                   VLPDSIRWMLLDDPALAVRCTHESRLPLTNRDRMRPILSDQVAYVIYTSGSTGRPKGVA
FT                   VTHRGLMNLVTDERELLGVTSGSRTLHFASPSFDASVFEMLMALGAGATMVIAPPTIYG
FT                   GSELAELLAAEHVTHAFSTPAALASVDHHGLDDLAVVVVAGDVCPPELVARWAPGRRMV
FT                   NAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALVLDGRLRPVPVGVPGELYVGGPS
FT                   LARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVRWRENRVLDFVGRTDHQVKIRGFR
FT                   IELGEIDAALTAHPQIEYATTIGYEHPNGETSLVAYVLPFTGEDVDRVEVANFVGRTLP
FT                   AYMVPASVTLLDALPLTPAGKLDRAALPEPIFVAAATTFEAPRNPMEVIVAGIFADILA
FT                   LPEIGIHDSFFDLGGNSLLATQVVSRINAALDVHVGVREVFESPTVAALAARITETTTH
FT                   GVRRPALTAKPRPEHIPLSLAQQRMWFINQFDTASPAYNLPVALRLSGEVDLRAMQIAI
FT                   ADLVGRHEALRTVYPDSVDGPHQVIVPAGDAVPDLTPVAAHPDDVLDRVLALVTTGFDV
FT                   TADVPLRARMYRVGADDYVLVMVAHHISGDGWSLAPLARDVMLAYTARAEGHVPRWTPL
FT                   PVQYADYSLWQRELLGDETDPESVAAAQIAYWTRTLEGLPDRPSLPTDRPRPAVASHLG
FT                   AHVPFTIDAGTHRALLALARGRNTSLFMVMHTALAVLLARLSNESDIAVGAPIAGRGEE
FT                   SLDELVGMFVNTLVLRTRVALASSFADSLADVRSADLNAFAHSDIPFERLVDVLNPARS
FT                   RAHHPLFQVAFSFQNLATTTLELPGLHVEGLDVPNTISNFDLHLTLSEKHDADGSPDVI
FT                   EAQFTYATDLFDESTVRAFAERFTRVLASVVEDPDVAVGAIDLLDGPERQSIVADFNDT
FT                   GVDLPPTTLAELFSAQAARTPEKAAVFFEGTELTYAEFDRRVDVLAHRLIDRGVGPESV
FT                   VGLAMNRSIELLVGMYAVLRAGGAYLPIDLTHPADRLAYVLATARPVCILTTSSDGFAA
FT                   ESVPVIEIDTLDHTGSPREPVTDARRLAPLRPENTAYLIFTSGSTGRPKGVAVTHAAIA
FT                   NQLRWKQHEYSLDTTDAVVQKTPVTFDLSVWELFWPLTTGARLVIARPDGHRDPAYLAD
FT                   LMRQQRVTTAHFVPSLLEAFLATPDAGEQPALRRVLCIGEALPVDTAARFRRRFGTVAL
FT                   HNLYGPTEAAVSVTAWTHTADDVDTVPIGGPEWNTQVFVLDARLNPVPVGVAGELYLAG
FT                   EQLARGYVARADLTAERFVANPFGASGSRLYRTGDVVRWHVRDSRGVLEYLERSDFQVK
FT                   VRGFRIELGEIESALVSSAGVGQAVVVAHQHPHTGTTLIGYVVPEDGATVDFAAVLAEV
FT                   GAAVPSYMVPAALVVLAQLPLTSNGKLDRRALPAPDFASATDEYRAPATPTEEAVAAVF
FT                   ADVLGVDQVGTAANFFDLGGNSLVATRVVARLSERLGCRVEIRTLFEAPTVAALAALLD
FT                   SIDATAPARPALTPAVRPERIPLSSAQHRMWFLNRFDPNSAVHNIPAAVRLSGALDVDA
FT                   LQHAVADVVRRHESLRTVYPDSADGPHQVILPIDRVGGEMSVVATDEAALPALIAGLVT
FT                   TGFDVTTEVPVRVRIFRMSATEHVLALVVHHISGDGWSMAPMVRDVMTAYAARSADTTP
FT                   DWAPLPVQYADYALWQRALLGDETDPESVSARQLAFWTHTLAGAPDQLDLPTDRPRPAV
FT                   ASYRGGTVDFTVPADLHGTLLGAARDANASLFMLVHAALAVLLSRLSGTGDIAIGTPVA
FT                   GRGERELDDLIGMFVNTLVLRQQVDGGRTFAELVADVRETDLAAFSHADVPFERLVEVV
FT                   NPSRSTGRHPLFQVMLTFQNLDQATLRLGDLSVSGVDFDVDIAKFDLQLTLMEQFDSAG
FT                   SPDGIAARLTYASDLFDEPSMHVFGQRFQQVLRAATDSPDTAVGDIDVLGSGERKQIAG
FT                   TNATSHEVPAGTLASLFDTRVAADPVRVAVIFDRDELTYADFDARVNRLARRLIEQGVG
FT                   PESVVAVAMRRSIDLLVAIYAVVKAGGAYLPVDPDHPAERTAHVLDTAQPACVLVSGAG
FT                   LAGGGSVPVIDVASEDVSGFDSSPVTDADRLWPLSPANTAYVIFTSGSTGRPKGVAVTH
FT                   GAIVNRLLWMQHEYTLTSADVVLQKTPVTFDVSVWELFWPLQVGASLVIAAPDGHRDPR
FT                   YLTGLIQERHVTTTHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEALTPEQVSRFRAVCG
FT                   ADLHNLYGPTEAAVDVTYWETGAADTVTVPIGRPVWNTQVHVLDSRLHPVPNGVAGELY
FT                   LAGDQLARGYLNRPDLSADRFVANPHVAGGRMYRTGDLVRRRADGVLEYVGRTDFQVKL
FT                   RGQRIELGEIEAALEAHPDVSQAVVVVHRDDRGEEALVAYLVGPRAADWSDVRAHLSAR
FT                   VPSYMIPAQVVHLDTLPLSANGKLDRTALPAPAARSAADEYQAPRTAAERAVATVFADV
FT                   LGIDRVGVTDSFFDLGGNSLIATRVASALGSELGIDFPLQWMFSDPTPQSLGQRIQKWT
FT                   NDGVDGAGASLDVLLPIRTRGTAEPLFCVHPFIGLAWSYAGLGRELTQDRPIYGLQSPA
FT                   LTEDEPHLETITDFAARYVREIRSIQPHGPYHLVGWSLGGVIAHEMGVQLQDAGEEVRL
FT                   LGLLDSYVGIDRSVENSATTADLLGGVGLDLPDDSVLDELAPDGQFDAERAAALLRVVG
FT                   GPLAALTATELERIYGNALRAPALIDAHRPRVFDGELVFFTAALDDGFHVDPVTCWGQF
FT                   VRGSIDEHPVDATHWTMTTPDALAAIAPHLERSHRRPRHAAPDTGRDSDPDDSANRPHS
FT                   VR"
     atgagtttcc gtgggtggcc ggtgggtgtc gtgcccaccg ccgtagtggg aaagaggacg        60
     aacaaggtgg tcgacgctgt gccgagtggt gatgtcaccg ccgtggatcg tattccggac       120
     ggtgcattcc cactctccac cgctcagcgg gggatgtggt tcgcccagca gctcgatccc       180
     gaggtgcccg tcaccatcgc gcagtgcgtg gaactggtgg gtgtcctcga cgtggcgttg       240
     ctgtcggagt cgttgatcac cgccggccgc gaactcggct ccgccttcct ccgcctcgtc       300
     gaggtcgacg gagttcccta tcagctggtc gatccgaccc tggacgcgtc ggtcaggttc       360
     gtcgacctgc agcgcgagcc cgatccgcgg gcggcggcca aggagtggat gcggcaggag       420
     tacaccactc cgctcgacgt gtgccgcgac cggctcgtca cctcggcggt cctgtgcacc       480
     gggccggatc gtcattactg gtacagccgt gtccaccacg tcgcactcga cggcatggga       540
     tcgatgacgc tcatcgaccg gactacgcag ctgtacaccg cagccgtgca ggggcgcacc       600
     gccgcaccgt ccaaggccgc cgcactcacc gacgtcgccc gggtcgacga cgactaccgg       660
     atctcgccgc gctaccgcgc cgaccaggag tactggtccg agcgggtatc caccatcggc       720
     gaaacgcaca gcctcgtcga gcgctccgcg cccgcacggg cacgaagccg aacggcgggt       780
     gggcagatcc ccgggaccct cgtcgaccac ctcgaggccg cgacggatcg tcacgactcg       840
     tcgaccgcgt tcgaggtcat tgcggcgttc gccgcgtacc tgtcccggat gaccggacgc       900
     gaagaggtcg cggtcagcct gcccgtcacc gcccgcacca ccgcgctgct ccgccgctcc       960
     ggcggcatgg tctccaatgt ggtcccgttg cacctgcacg tccgtccgga catgacgaac      1020
     gcggacctgg tggcggcggt ccggctggaa gtcaccgcgg cactccgcca ccagcgctat      1080
     ccgcacatcg acatccggcg ggacgccgcc accgagcacc agggcttcta cggtcccctg      1140
     atcaacgtca tgctgttcca cgacgagatc accctcggca gcatcgtcgg caggctcgaa      1200
     ctgctgtcca ccggtccgat caccgacctc gcggtcaacg tctatcacgg agtcgccggt      1260
     accagcctca acctggactt cgaggccaac cccgacctgt actccgaagg caccctccgc      1320
     gcccatcaca cccgcttcac ccggttcctg ggcgcgttcc tgacctccga caccgatgaa      1380
     cctcgacggg tcggcgacct cgacatcctc gacgacgacg agagccgcac cctcgttccg      1440
     gcttccggcc gcgccgggtt cgcacccgtc actctgcccg acctcctcgg gggtgccgtc      1500
     cgcagcaacc gggacgggga cgcactcgtc gcacccgggc acgggatctc ctccgccgac      1560
     accctgagct accgcgccct ggacgaagcg tcgaaccggc tcgcgcggct actgatcgac      1620
     ctccaggtcg gcccggaggt catggtggcg ttggcgttgc cgcggtcgcg ggagtctgtg      1680
     tcgagcgtgt gggcggtggc gaaggcgggc gcggcgttcg ttccggtcga tccgagcctt      1740
     ccggccgacc gcatcgcgtt catgctggag gattgtggtg cgccgatcgg tatcaccacc      1800
     gccgcgttgc gggatggtct gccggagtgc acgcactgga tcgtgttgga cgacgacgag      1860
     tttcgggcga ccgcggcggc gtatcccccg gatgcggtca cggacaccga tcggacgcgg      1920
     gcgttgtcgg tcgatcaccc ggcgtatgtg atttacacgt cggggtcgac gggcaggccg      1980
     aagggtgtgg cggtcacgca ccggggtgtg gtgaatctgg cggcggacga gcgtgaccgt      2040
     ctggtggtgt cgtcgggttc gcgggtgctg catttcgcgt cgccgagctt cgatgcctct      2100
     gtgttcgagt tggtgatggc ggtgtgtgcg ggtgcgaccc tggtggtggc gccgaccacg      2160
     atttacggtg gcaccgagtt ggcggagctg atggccgagc agcgggtgac gcatgcgttc      2220
     tgcacgccgg cggccttggc gtcgctcgat caccgcggtc tggaccatct gagaacggta      2280
     gtggtggcgg gtgatgtgtg cccgccggag ttggtggcgc ggtgggcgcc gggccggatc      2340
     atggtcaatg cgtacggtcc gagtgagacc acgatcatgt cgtccgctac cggaccgatg      2400
     gtgcccgggc agccggtcac cgtcgggtca ccgaccgtgg gtgtcgatct cgtcgtcctc      2460
     gaccaccggt tgcgtccggt cccggccggg gtgcgcggcg aactctacgt cctcggctcc      2520
     agcctggctc gcgggtatgt gcgccgggcc gggctgacgg cggagcgttt cgtggcgagt      2580
     ccgttcggca ccggcgggcg gatgtaccgc acgggtgacg tggtccgctg ggtgaccgcc      2640
     ccggacgggc ctccggttct ggagtttttg ggccgcagtg atttccaggt caagatccgg      2700
     gggttccgga tcgaattggg tgagatcgac gccgcgttga ctgcgcatcc ggtggtggag      2760
     ttcgcctaca cggtcggcta tgacgacggg agcgggagca gtcgcttggt ctcgtacgtg      2820
     ctgccggtgc cggcaaccga cgtcgaaacc cgggtgttgt cggagttcgt cggggagcgt      2880
     cttcccggat atatggtgcc gtcgtcgatc atgatgttgg attcgctgcc gctgaccccg      2940
     gccggcaaac tcgaccgcaa cgccctgccc gcaccggtat tcgccgcacg ctcggccgac      3000
     atcgtgcgcc cgagaacggt caccgaggag atcctcctcg ggatcttccg cgacgtcctc      3060
     ggcctgcccg aactgagcgt cgacaccagc ttcttcgaac tcggcggcaa ctcgctgatg      3120
     gccacccagg tcgtgtcccg ggtgaacacc gccctcggtg tgcggatcgg ggtccgcgac      3180
     ctcttccagt cgccgtcggt gtcgcaattg gcggtcccgg cggcgaacac cggcccgcag      3240
     gccgactcgc gtccggtgct ggaggcgcgg gaacgacccg accacgtgcc gctctccgtt      3300
     gcgcagcaac gcatgtggtt cctcaaccag ttcgacacgg cgtcgcccgc ctacaacctg      3360
     ccgatctccc ttcggctcac cggcgcactc gaccgggaag ccctgcgagc ggcactcggc      3420
     gatgtccagg aacggcacga ggcgctgcgc accgtcttcc ccgacacccc ggacggaccc      3480
     caccagctgg tcgtgcccgt cgtgagcgtg ctggccgaga cggatccgat cgacgtcgac      3540
     gcgaagtcgc tcaccgccgc agtgacggcc ctcggcggtg ccggattcga cctcaccacc      3600
     gacacgccgc tgcgcgccgg gctgttccgg gaggcgcccg accggcacgt tctcgtcctc      3660
     gtggttcatc acgttgccgc cgacggctgg tccatgacgc cgctggccgc cgacgtgatg      3720
     gtcgcatacg cggcgcgcgt cgccggtcac gcgcccacct gggcgcccct cccggtgcag      3780
     tacgccgact acaccctctg gcagcgtgaa ctactgggtt cggaagacga cccggacagc      3840
     gtgtccgcgc ggcagatcgc ccactggcag tcggcgctcg ccggagtgcc tcagctgctc      3900
     gagctgcccg ccgacaggcc gcggcccgcc gagatgtcgc atcggggcgg tcgtgtcgaa      3960
     ttcacgatca cggccgacgt ccacgggcgt ctcgtcgatc tggcgcagag caccggcacc      4020
     acgctgttca tggtcaccca cgcagccctc gtggtgctgt tccatcgcct cggcgccggg      4080
     acggacatcg tcatcggcac cccggtcgcc ggacgcggcg aggaggcgct cgacgacctg      4140
     gtgggcatgt tcgtcaacac cctggtgctt cgtgcgaccg ccgagccggg cgacacgttc      4200
     gaggaggttc tcgaccgggt ccgggacgcc gaccttgccg cgttctccca cgccgacgtc      4260
     ccgttcgagc gcctcgtgga ggtgctcagc cccgaccggt ccgccgcgcg tcatccgctg      4320
     ttccaggtca tgctctcgtt ccagaacacc gcgccgacct ccgtcgaact tccaggcctc      4380
     gaggtcgcgg cggcggaaat cgatgtccat gttgcgaaat tcgacctcca gttgaccgtc      4440
     accgaacggt tcgtcggggc gggcatgccg ggtggtctcg cggccggctt cgattacgcc      4500
     accgatctgt tcgacgagtc gaccgtagcg tcgatggccg agcgattcgc gaacctgttg      4560
     cgctcggtcg cggcttcctc cgcgacggtg gtcggtgatc tgtccctgct ccacgccgcc      4620
     gaacgcgacc gtcttctcgg cacgtggaac gacaccgcgc accgcgtgcc tgcgatgtgt      4680
     ctgcccgagc tgttcgacgc gcaggttgcc cgcaccccgg atgcggtcgc ggtggtgttc      4740
     ggagacgtca cgctgtcgta ttcccaactc gattgccgcg cgaacagtgt ggcgcgctac      4800
     ctgatcgacc ggggagtggg acccgaatcc cgcgtcgggc tggcgatgcg gcgctcaccg      4860
     gacctgctgg tcggcatgta cgcgatcgtc aaggccggcg gtgcctacgt gccggtcgat      4920
     cccgaccacc cgacggaccg gatcgggtat gtgctcgact ccgcacagcc cgtctgcgtg      4980
     ctcacgacct cggccgaccg cggcgcactt cccgcgggtc agtcattcgt ggagatcgat      5040
     cggatcgcgc tcgattccta ttccggcgga cccgtcaccg actccgaccg actggcacca      5100
     ctccgccccg acaaccccgc gtacgtcatc tacacctcgg gctccaccgg tcggcccaag      5160
     ggtgtgtcgg tgccgcaccg cgggatcgtc aatcagctcc tgtggatgca gtcggaatac      5220
     gcgctcaccg aacgggacgt gctgctgcag aagaccgcaa ccactttcga cgtatcgctg      5280
     tggggctact tctggcccct gcacacgggc gccacgatgg tgctggccac cccggacggt      5340
     caccgcgacc ccgagtacct cgctcgggtc atcgacgagc acggtgtcac cgtcaccgac      5400
     ttcgtgccgt cgatgctcga cgccttcgtc gcgtccgtgc ccatcacctc gtgcagcact      5460
     cttcggcacg tcttcgtgat cggcgaggcg ctgcccccgg agaccgtcac gcggttccgg      5520
     gcgctgtccg atgccggact gcacaacctg tacgggccca ccgaggcggc agtctcggtc      5580
     acgtactggg acaccgcgac cacggtcgcc ggcacggtgc cgatcggcgt gcccgagtgg      5640
     aacacccagg tttacgttct cgattcgcgt ctgcacccgg ttccccccgg cgttgccggc      5700
     gagctctacc tggcgggcga gcagctcgcc cggggatacc tcggccgcgt cgatctcacc      5760
     tcggaccggt tcgtggccaa tccgtttact cccggcctgc gtatgtaccg caccggcgac      5820
     ctcgtgcgat ggacgtcggc gggcgccctc gaatacatcg ggcgcaccga cttccaggtc      5880
     aagttccgag gtcagcgcat cgagctcggc gagatcgaat tcgtcctgcg ggcacaaccg      5940
     tcggtcacca gcgctgccgt gctggtccat tccgatcccg gcaccggcga tcgcctcgtc      6000
     gcgtacgtcg tgcccgagcc gggacacgac ctcgatacca cgcgacttcg agagtgcgcg      6060
     gccgcgtccc tgccggcgta catgattccg gcggcgctga tggtcgtcga cgaattcccg      6120
     ctcaatacaa gtggaaagct cgatcgtcag gccctgcccg cacctgaatt cggtggttcc      6180
     ggcacggagt acgtggcccc gcgcacgtcc gtcgaggcca acctcgcgga gatcttcgcc      6240
     gaggttctcg gtctcgaccg tatcggcctc cgggacaact tcttcgacgt cggcggtaac      6300
     tcccttgtcg cgacgcgggt cacctcgcgt attcgggccg agttgggtgc gccgctcgcc      6360
     ttgcgtgacc tgttcgatgc ccccaccgtc ggggcgctcg cggagcgcat cgagggaaca      6420
     gtgcagacga caccgcgcgc cccactggtc gccgccacgc gcgccggacg gattccgctg      6480
     tccccggcac aacgtcgcat gtggttcgtc aaccagttcg ataccgcatc cgccgcctac      6540
     aacatgccct tcgccctgcg gctgtccggc attctcgact gtgacggcct gcgttcggcg      6600
     attcgcgacg tcctcgagcg tcacgagtcc ctgcgcaccc tgtatccgga ctcgacggac      6660
     ggcccacatc aggtgatcgt cggcgccgac gaggtgcccc tcgatctcga cgtgcagccg      6720
     atcaccgagg ccgagctgcc gacgcgactc gtggagctcg ccaccgaggg cttcgacgtc      6780
     acgtccgcgg tgccgctgcg cacggcattg ctacgactgt ccgtcgatga gtacgtgctc      6840
     gccgtggtgg tgcaccacat ctccgccgac ggatcctcga tggccccgct cgcacgtgac      6900
     atcctgctcg cctacacggc gcgtacggct gggcgggcac cgtcgtggcc gccgttggac      6960
     gtgcagtacg cggactacag ctattggcag gcggagtttc tcggcgacga gaccgacggt      7020
     cggtcacagg ccaccgagca gatcgaattc tggtccgcgg cgctcgacgg catccccgac      7080
     ctgctggagt tgcctgctga tcggccccgc ccggccatgc cgacgaattc gggtgcgacg      7140
     gtaccgttct cggtcgacgc tgccacggcg aaagccgtcg ccgacctcgc agcccgctcc      7200
     gctgccacgc cgttcatggt gtggcacgcc gcgctgtcgg ttctgctctc acggctctcg      7260
     aacgcggtgg acgtcaccgt gggcacgccc gtcgccggtc gtgccgaacc ctctttgcag      7320
     gacctcgtcg gcatgttcgt caacactctc accctgcgcg ctcgagtgtc cggtgacctg      7380
     tcattcgccg acctgcttgc gcaggtgcgg gagttcgacc tcgccgcgtt cgcgcacgcc      7440
     gatctgccgt tcgagcgtct cgtggaggta ctcgaacccg cgcggtccac agcccgtcac      7500
     ccacttttcc aggtgggtct gtcatacgag aacttcgaac cgggagtgct ggaactaccg      7560
     ggtctgacgg tgagcgccgt cgagatgaat ccggagatcg cgaaattcga tctgaacgtg      7620
     acgctcaccg agatccgcga cgagcgcggc accgtgtccg gtctcaccgg tgcgttcacg      7680
     tatgcggtcg atctgttcga ccgcgacacg gtggagtcgt tcgcggaccg tttcgcgcgg      7740
     atcgtgacgg cggcgctggc cgatccgggc acggcggtgg gggacctgcc ggtgctggat      7800
     caacgggaac tggttcgcgt actgcgcgaa tggaacgcca cggacgtgga ggtgagcggg      7860
     cgcccctacc tcgcccgcta cgacgagcag gcggcacgga cgcctgatgc ggtggcggtg      7920
     gtgtaccgcg acgtgtctgt gacgtaccgg gaattcaact cgcgggtcaa ccggctggcc      7980
     cgcaaactca tcgccgaagg cgccggaacc gaaaccaccg tcgcggtcgc agcccgccgg      8040
     tcgatcgagt ttctgatcgc cctgcacgcc gtgttgcgga gtggtgcggc gtacgtgcca      8100
     ctcgacgtcg accttccggc ggagcgagtg gcccatgtca tcgaggcagc ccacccggtt      8160
     ctcgttctga ccgcagttcg aggcgagttc gagtcggact ccggagtccg ggttctcccg      8220
     atcgacggtc tcgaactcga ccggttcgac gatgccccgg tgacgaaccg cgaccggctg      8280
     cggcctctcg cggccgacaa cctcgcgtat gtcatcttca cctcgggttc gaccggccga      8340
     cccaagggag tggccgtctc gcacgccggt ctcggaagcc acttcgagtt cctgatgtct      8400
     ctctgcgcgc tggacgagac cgatcgggtt gtcgtcaaga caccacagtc gttcgacgca      8460
     tcactctggg aactgttgtg gcccctggct gtgggcgcac gcgtcgtgat cgcggaaccg      8520
     gacggacaca aggatcccga ctaccttgcg gaactgatcg ataccgagca gatcacggcg      8580
     atacatttcg tcccgtcgat gctcgccgtc ttcaccgacg taatcgcgcc gtcccggttc      8640
     tcgtcgctgc gtaccgtgtt cgtcggcggc gaggcactgt ccgtcaatgt ggcgcggcgg      8700
     ttcgcggccg tctccgacgc tgccgtcctc aacgcatacg gtcccgcgga ggtcgcggcc      8760
     gcctccacca cctcatgggt ggacacctcg aactcggcca tcgtcaccgt gggtacaccg      8820
     gtgtggaaca cccgagccta cgtgttggac cagcggctcc accccagtcc tgcaggggtg      8880
     accggtgagt tgtacctggc cggcacgcag gtgtctcgcg gatacgcggg acggcccgac      8940
     ctcaccgccg aacggttcgt ggcgaacccc ttcgacgcgc cgggcactcg gatgtaccgg      9000
     accggtgacc gtcttcgctg gaccggccgg ggcgaattgg aatacctcgg ccgcaacgat      9060
     ttccaggtga agctgcgcgg actgcggatc gagctcggtg agatcgaggc ggtactcgag      9120
     tcggcggact cggttgccca ggcggtcgtg accgtgtact ccggagcggc gagcgaacaa      9180
     ttggtggcct atctcgtcgc acgtgcgggc acgagggtcg acatagaggc actgacggcg      9240
     tatgccgcga gtcggctgcc cgaatacatg gttccggacg ggttcgtcac gctcgacgcc      9300
     ttcccgctca acgcgagcgg caaactggat cgagtggcgt tgcctgcccc ggccgtcggt      9360
     gacgtcgcgg tcgatcgagt ggagccacgt actccgatgg aggaatcact cgcggccttg      9420
     ttcagggagg cgctcggcgt cgacgacctg ggggtgaacg actcgttctt cgctctcggc      9480
     ggcgacagca tcgtatcgat ccagctggtt tcgcgagcca aggccgcggg gatcgtattc      9540
     accccacggg acgtgttcga gcgcaagagc attgccgcgc tcgccgaagt ggttaccgtc      9600
     gcgtcggcgg atcgactcgc gctcgccgaa ctggcgggtg gcggcgtggg aaacgtcgag      9660
     ttgacaccgg ttgtccgatc actgctcgac cggtcgggtt cggtgggccg gtattcgcag      9720
     tccgtgttac tgacgctgcc gaccgggatc gagcgatcgg acatcgtggc gacggtgcag      9780
     gcggtgctcg acaggcatga cgcgctgcgg tcccggctgg tccgcgacgg tgcggacgtg      9840
     cgtcactcgg tgttgcccac cggtgccgtc gacgccgatc gactggtcac gacggtgtcc      9900
     gtgaatcccg acctcggcga cgcagccttc gatgcgctga tcgaccgcga actctccgcc      9960
     gcggccgacc ggttcgactt cgagaccccg gtgctcacgc agttcgtctg gttggatcgt     10020
     ggtgcgaccc ggcccgggcg gctcctcgtg gttgcgcatc acctggtcgt cgacggtgtg     10080
     tcctggcgga tcatcgtgcc ggacctcgtt gcggcgggag gtgccgtcgc ggccggtcac     10140
     gctccgaacc tgccggaggt cggtacgtcg ttgcggcggt ggtcgcacgg gttgtcggag     10200
     gctgcccgtc agccgtccac cgtcgcgcag ttcgactact ggcgaagtgt tgtcgacgct     10260
     gcggacccgc tcctcggcgg cagggctctc gatccggtgc gggaccggac ctcgaccacg     10320
     caggagctgc acgtcgagct gtccaccgag ataacggcca cgctgctggc ccgcgtgccg     10380
     gaggcattcg ggtgctctgt cggtgattcg ctgcttgccg gcttcgcggt ggccctcacc     10440
     gaatggcgcc gtgcgcgcgg ggtgcccgcc gcctctgcgt acatcacgct cgagggtcac     10500
     ggccgcgaag agtcggtcgt gccgggcgcc gatctgtctc gtaccgtggg ctggttcacc     10560
     agcgtttatc cggtgcggct cgccctcgag ggggtggaca cacaggacgc actcgtcggc     10620
     ggcgcgtccg ccggcgccgc gatcaaggcg gtgaaagagc aactcctggc ggtccccgac     10680
     cggggcgtcg ggtacggact gctgcggtat ctcaatccgg cgacggccac cgttctcgcg     10740
     ggcttcgacc cgccccaggt cgtcttcaat tacctcggaa agaccgggat gggcgatctg     10800
     tccccggaga tgcgcgagat cggctgggtg ccggatctcg aatcgtcgcg cgtcttctca     10860
     ggtgaaaccg atcaggacat gagcgcgtcc gcagcgatcg agatcaatgc cggagtgacg     10920
     gatacggatg ccggaccgcg actcggagct tcggtgcggt tcgccggtga actgctcgca     10980
     gccgacgacg ttcgcgaact cgtcgatctg tggcagcagg cgctcgtctc acagatcgag     11040
     cacgtcgtcg ccggatccgg tggggggctg accccgtcgg acatcggcac ggtggcgctc     11100
     acccagtccc agatcgacct ctgggagcgg gcgtacccga ccctcgagga tgtgtgggcg     11160
     ctgtcgccgc tgcaggccgg tttccacttc cattcactgt tggccgccga gcacagtgtc     11220
     gatgtctacc attctcagct gcggatgacc ctgctcggcg acgtgtcggc ggatcggatg     11280
     cgggccgctg ctgctgcgct cctggaccgg tactccaacc tgcgggtggt gttcgtgcag     11340
     gacggcgacg tcaccgcgca gatccccctc cgcggggtgg aggtcccact gaccgtggtc     11400
     gacctctcgg gccgtgagag tgattccggg gaaagggaac tcgagtcgct cgtcgcagag     11460
     aaccggaccg cgccgttcga cttgtccgag gcgccgctgc tgcgactgct gctcgtgcgc     11520
     acgggagccg atcggcacga gttggcgatg accaaccacc acatcctcct cgacggatgg     11580
     tccatcccgc tgatcgtcca ggacctgctg gtgctctacg cgaccgcggg cgatcagtcc     11640
     gcactgccgg cggtgcggcc ctaccgggaa tacctcgact ggctgacccg tcgagacccc     11700
     tccgcctcgc gggccgcgtg ggcgcacgcg ttggaaggct tcgacgagcc gactctgctt     11760
     gcacctgccc acaccggcgg cagcgcaacg gcggacccgg aggaagttcc ggtccacttt     11820
     tccgcggcgg acaccgccga gctgctggcg ttcgcccgac agcacggcgt cacgccgaac     11880
     acggtgatcc agaccgcctg ggctctgctg ctcaggcgac tcaccggacg ggacgacgtc     11940
     gtattcggcg ctaccgtctc gggccgcccc ccgcacatcc ccgggatcga gtcgatggtc     12000
     gggctcttca tcaacaccgt ccccgtccgg gtacgaatcg acgccgacga gtcggtggcc     12060
     gaattgctgg tacgggtgca ggggcagcag gccgatttgc tcgatcacca ctacctcggc     12120
     ctgacggaaa tccaggcaga ggcgggggtc ggggcgctgt tcgacacgct caccgtcttc     12180
     gagtcgtacc ccatggatca ggcggcgctg caggcgcaga ccgacatcgc aggtatgcgc     12240
     gtggactcgg tccaggtgca cagtgtcacc cactacccct tgagcctgat ggcccaggtc     12300
     gacgacaccc tgcggctcgg ggtggcctac ctgccggaca cctttgagcg cgacgaagcg     12360
     aggttgattg cggcgcggct cgattcggtg attcgagcgt tgatcgcaga gccctccgcc     12420
     gcggtcgccc aggtcaccgg attcatcccg ggcgagtatg cgcgggtgat gcacgactgg     12480
     aacgccaccg gccaccacgt gccggagtcg acgctgctga cgttgttcga ggcgcaggct     12540
     gcgcgtacac ccgatgctgt tgctgtcgat ttcgacggtg acgtgctgac gtacgcagcc     12600
     ctcgatgcgc gcgcgaacca gctggcccgg catctgatcg cgctgggcgt cgcccccgaa     12660
     acccgagtgg ccgtggtgat gcggcggtcg ctggaactgg tcgtcggaat ctatgccgta     12720
     ctcaaggccg gtggtgcata cgtgccggtc gatcccgatc acccggcgga gcgaacgagt     12780
     tacgtgctcg cgtcggcgca gccggtgtgc gtgctgacca cctcggccga ccgaccggac     12840
     ctgccgaacc ggatccccgt gtcggccctc gacactctcg acctctcggg tgtctctgcg     12900
     gtgccgttga ccgacgccga gcgtatcgaa ccgttgcggc ctgcacaccc tgcgtacgtc     12960
     atctacacct ccggctccac cggcaagccc aagggggtcg cggtaccgca tgcggcaatc     13020
     gtgaatcaac tgctctggat gcagtcggag tacgcactca ccgatcggga tgtgtggttg     13080
     cagaagaccg caaccacgtt cgacgtgtcg ttgtggggct acttctggcc ccttcaggtg     13140
     ggtgccacca tggtgctggc cactccggac gggcatcgag agcctgccta cctgactcgg     13200
     gtcatcgacg agcgtgcggt gacggttacc gatttcgtgc cgtccatgct cgacgtgttc     13260
     gtcgcggccg ccccggaggg gacgtgccgt tcgttgcggc tcgtgttcgt catcggcgaa     13320
     gcgctgccgc ccgcgacagt tctgcgtttc cgggaactct ccgcggccgg actgcacaac     13380
     ctgtacgggc ccaccgaggc cgcagtgtcg gtgacgtact ggaagaccgg tgacgccgac     13440
     accacgaacg tgccgatcgg tgtgccggaa tggaacacac aggcctacgt gctcgattcc     13500
     cggctgcacc ccgttcccgt cggcgttccg ggagagctct acctgggcgg tgctcagctc     13560
     gcacgcggat acctcggccg cgtcgatctc acgtccgacc gattcgtcgc gaacccgttt     13620
     ggacgcacgg gcgagcgcat gtaccgcacc ggcgacctcg tgcgatggac gtcgtcggga     13680
     gcgctcgtct acatcggacg taccgacttc caggtgaagt tccgtggtca gcgcatcgaa     13740
     ctcggcgaga tcgagacagt gctccggtcg cacccggcgg tcaccggcgc cgtcgtatcg     13800
     gtgtactccg acaccaccgt cggcgatcat ctggtcgcgt atgtcgtcgg tacacccggc     13860
     gagttggacg tcgcggagct tcgccggcag gcttcggaat cccttccgtc gtacatggtg     13920
     ccgtccgcga tcacagtgct cgacgagttc ccgctgaaca ccagcggaaa actcgatcgt     13980
     aaggagttgc ccgctcctga attccacggg agttcgaccg agtacatcgc gccgcgaaat     14040
     gaggccgagc gcacagtcgc ggcagtgttc gctgacgtgc tcggttcgag ccgggtcggc     14100
     gcgcacgaca acttcttcga tctcggcggc aactcgctct ccgtcacacg agtggcggct     14160
     cggctcggtg agttgtcggg caccggactc tccgtgcgcg atgtgttcac cgcgcccacg     14220
     gtcgcggagt tggctcgtcg tctcgccgag cccacggccg cagggggcgc gcgcccggtg     14280
     ctgtccggga tgcagcgacc ggcccggata ccgctgtcac cggcgcagca gcggatgtgg     14340
     ttcatcaacc agttcgaccc ctcctcgccc gcgtacaacc tgccgttcgc ggtccgcatg     14400
     tccggtgctc tcgatgtcgc cgcgctgtct caggcactcg acgacgtagt cgggcgccac     14460
     gagtcgcttc gtaccgtttt ccctgacacg gacgacggac ccgcccaggt cgtcgtgtcc     14520
     gcggcagatc tctcgatgcc cctcgaggtc gtggacgtac cggagggcga gctcgattcc     14580
     cggatgattg cattctcgtc gcacgggttc gacgtgtccg aggacttgcc ggttcgggca     14640
     acgctgttcc gcaccggtcc cggcgaacac gtcctggcga tcacgctgca ccacatcgcc     14700
     gccgacggct ggtcgttcgg acctctcggc gcggacgtca tggtcgcgta cgcggcccga     14760
     gcagagtcgc gaagtccgga gtggattccg cttgctgtcc agtatgccga ctacagtgtg     14820
     tggcacaggg cggttctcgg cagcgaggac gagccggagt cactcgcccg gcgccaactc     14880
     gagtactgga cgcggacgct cgacggtctc ccggacgagc tgaaactccc cttcgaccgc     14940
     ccgcgccgga ctgagcagtc ctacgtcggg ggatccgtgg gcttcaccat cacccccgag     15000
     attcacagcg gcatcgaacg gttggcgcgt gaacacgggg ccacggtctt catggtggcg     15060
     cacgctgcct tcgcgctcct gttggcccgc ctgtccgcgt cggacgatat cgccgtcggc     15120
     gctccgatcg cgggacgtgg cgaacgtgct ctcgacaacc tggtgggaat gttcgtcaat     15180
     acgctcgtgc tccgcacgcg catcgagagc accgagacgt tcgcggagtt gctgacgcgg     15240
     gtacgcgacg gcgacatcgg ggcattcggc cacgcggacc tccccttcga gcgtctcgtc     15300
     gacgtactcg accccgtgcg gacgtccgcg catcacccgg tcatccagac tgcgctgtcg     15360
     atgcagccga cggccatcga cgacatcgag ctgcccggac tccgggtgcg tgtcgaggac     15420
     atcgacgcgc gtgtcgcgaa gttcgacctg cagctgacat tgggtgagga catcgatccc     15480
     gcgggcgttc cgtcgggtat tcgcgccgag ttcacctacg ccgcagactt gttcgacgac     15540
     gttactgtgc gccggtacgc ggggcagctc gtgcgaatcc tcgaaacggt gattgcagac     15600
     ccgaccacgg tggtcggcga cgtgaatctc ctcgacgacg ccgagagggc ccgcctggca     15660
     ccggttcgcg ggcctgcgag tcgacctagt cgactgcttc ccgaagttct agccgagtcg     15720
     gcggccgacc cgtccgcgac ggcgctcgtc ttcggcgacc gttcgatgac ctacggagaa     15780
     ctggaccggc gatccaacct ctgggcgcgc gaattgatcg aagccggagc cggacccgag     15840
     acattcgtgg ccgtcgcgct cgcccgctcg atcgaatcgg tgctcgccgt ctgggccgtt     15900
     gccaagacag gtgccgcgtt cgtgccggtg gatccgaact acccggccga acgaatcgca     15960
     cacatgctcg gcgattcggg gtccgcgctc ggcctgacga cgatcgagtt ccgagccgga     16020
     ttgcccgact cgacacagtg gctcgtgatg gacgatcccg accacactgc gctggtgacg     16080
     tcccactcct cggccgcggt gacagcggcc gatcgcctcg gacggatgca cgcggaccaa     16140
     ctcgcctacc tcatctacac atccggatcc accggactgc ccaagggcgt cgccgtcaca     16200
     cactcggggc tcgcgaacct cctgaccgag ctggccgacg agtacgagct caccgccgac     16260
     gcccgtaccc tgcacttcgc atcacccagt ttcgacgcct ccgtatttga gtatctgatg     16320
     gccttctgca ggggcgcgac gatggtggtc gttccccact cggtgtacgg cggtacggag     16380
     ctcgccgaac tcctgggcgc gcaaggagtc acgcacgcct tcttcacacc ggccgcgttg     16440
     gcgtccgtcg accacacggg actcgacgaa ctcgccgtca tcgtcgtcgg cggagaggcc     16500
     tggggtgccg acctcgccga gcgttgggta ccggggcggg cactgttcaa cggatacggg     16560
     ccgaccgagt cctcgatgat ggtgacgcag tctggaccgc tgatgctcgg cgagcggatg     16620
     accatcggcg ctcctgtgcg cggtgtcgag gctttcgttc tcgacgcgcg gctgcatccc     16680
     gtgtcacccg gtgtgccggg ggagctgtac atatcggggc cggcgcttgc ccgcggctac     16740
     caccagcgac tcggtctcac cgcggagcgt ttcgtcgcga acccccacgg tgcacccggt     16800
     cggcggatgt accgtaccgg tgacctcgtc cggtgggtcg agtcccgcac cgggacatac     16860
     gtcatcgaat acgtcgggcg cagcgacttc caggtgaaga ttcgtggatt ccgtgtggaa     16920
     ctcggtgaga tcgactccgt gttccgagcg cattctgcgg tcggattcgc cgcaaccatc     16980
     gcgcacgaca ccgaatccgg cgttacagca ctggtcacct atgtctgcgc tgcgtcgggg     17040
     aacgacgtcg acgtcgacga cttgaccgca ttcgtcggcg gtgtgttgcc ggcgcacatg     17100
     gtccccggtt cgatcatggt tctcgactcg atcccgctga caccggcggg caagctcgac     17160
     cgccgcgccc tccccgagcc cgtgttcgtg agccataccc gattcaccgc acccgacaca     17220
     gcggacgaga tcgcagtcgc cgcagcgttc gcggatgtgc tgggtgaatc acgcatcggt     17280
     gtggacgaca acttcttcgc tctcggtggc aactccttgt ccgccaccca ggtggtttcc     17340
     cgggtcggtt cagcgttcgg cacccgtgtc tccgttcgca cgctgttcga caaccccact     17400
     gtgcgtcaac ttgtctccgc agtggccacg tcggggccgg acgcgtcctc gggtcggccc     17460
     gcgctgaccc gacgcgagca tcccggacga atcccgttgt cgctggcgca gcagcggatc     17520
     tggttcctca accaatacga tccttcgtcg tccgcataca acattccact cgcactgcgg     17580
     atgtcggggc gtatcgacgt cccggccttg cgtgccgcgc tcggtgacgt tctggaacga     17640
     cacgagtcgt tgcggaccgt gtacccaggt tctgcggacg gtgcgcatca ggagatcctg     17700
     ccggccgccg ccgcagaatt cgatctcaca ccgatccgaa ccgcgccgga ccagctgatg     17760
     ctccggatcg ccgagtacgc agtcgccggt ttcgatgtga cccgggagat cccgttccga     17820
     atccacctgt tccgggagaa ccgttccgaa cacgtgctgc tgctcgtcgc gcaccacatc     17880
     gcggcagacg gatggtcgtt cggtccgctc gccgccgacg tgatggccgc atatgcatcc     17940
     cgagtggaag ggctggcgcc gtcctgggag ccgctgcccg tccagtacgc cgattacagt     18000
     gtgtggcagc gggaactgct cggcgccgag gacgatccgg acagtctgtc cgccacgcag     18060
     atcgagcgtt ggcgtgcggc gctggacggt gcgcccgagg cactcgatct gcctacggac     18120
     cacccccgtc ccgcggtagc gtcgcaccgc ggtgaacgcg tggacttcga gatcgatgcc     18180
     gacacccacc gggggctggt cgagcgcgcc cagaagggcg gcactacgct gttcatggtt     18240
     gttcatgcag cgttcgcgac gctcttgcac aggctcagcg gcagcacgga catcgtgatc     18300
     ggcacacccg tcgcaggccg cggggacgag ggactcgacc cgctcgtcgg aatgttcgtg     18360
     aacaccctgg ccttgcgcac acggattgac cccggcgaga gtatcgacgc tctcctggaa     18420
     caggtgcgcg atgtcgatct cacggcgttc caggacacgg aggttccctt cgaccggctc     18480
     gtcgagatcc tgcgtcccac ccggtcgtcc gatcggcacc cgctgtttca ggtgatgttc     18540
     gccttccaga atctgcggcc ggtgacgatg gaactgccgc agttggtggt agaggccgtc     18600
     gacttcgatc ctcacatcgc gaagttcgat ctggatctgg cgctcgccga gatcgtggac     18660
     gacgccggac accatcacgg gatttccggt gccttcacat tcgcatcgga actcttcgaa     18720
     cgcgccactg tcgcgggatt cgcggaccga ttcctgcgga tcctggaggc ggtcgcttcc     18780
     gccgacgata tcgccgtcgg cgatatcgcc atcctgggtg cggccgagca agggtccctc     18840
     gcaccggtgt ggggcgggcc gttgctcgcg aacgccaccc tgcccgagct gctcgtcgcg     18900
     acggcggaac ggtatccgga ctcgactgcc gtcgtcttcg acggtgtctc gatcgattac     18960
     cgtgagctgg accgacgatc gacacagctg gcacgtgcac tcatcgggat gggcgtcggc     19020
     ccggaaacct acgtcgcact agccttgccg cgctctgtcg aatcggtgct gtgcgtgtgg     19080
     gccgctgcca agaccggtgc ggcctacgtt ccgatcgacc ccgcgcatcc ggcggaccgc     19140
     atcgcgcaca ttctgcggga ttcgggagtc gtcgtcggtg tcacctgcgc cgagttcgcc     19200
     gaacacctcc cgggggtgac ggactggctc gtactcgacg atccggcagt gctccgcgaa     19260
     ttgtcctcgg cgagcactgc gccggtcggg gatgcggatc gtacctccgc tctgcacgtc     19320
     gatcatcccg cctatctcat ctacacgtcg ggttcgacgg gactgcccaa gggcgtggtg     19380
     gtgtcccacc gcggtctcgc gaatctcgcc ggctcgtata ccaccgcagt gcgggccacc     19440
     gaggaatccc gggtcgcgca cctcgcgtcc ccgacgttcg acctgtccgt cctcgaactg     19500
     cttctggccc acacttccgg ggccgcgctg gtggtctgcc cgcccggtgt gtacggcggc     19560
     gtagagctac acgaggtgtt gcagtccgaa cgcgtcacgc acatgaccat cacgaatgct     19620
     gctctggcgt cggtcgagcc ggagggactg gacgatctac gctcgatcgt cgtcggcggc     19680
     gacgcctgcc caccggagac ggtggcgcga tgggccgacc gactcgaact cgtcaacggg     19740
     tacggtccca ccgaagtgac ggtgggcgcc acgttcagct cggtgctcgg ccagggccga     19800
     gacatcacca tcggcgggcc gctgcccggg gtcgccgccg tggttctcga ttcgaggttg     19860
     cggcccgtgc cggtcggtgt cgtgggagag ctgtacctgc tgggaccggc tctggcacgc     19920
     ggataccacg agcgtgccgc gctcacggca caccgcttcg tggccagtcc gttcgaggcc     19980
     gccggtgccc ggatgtaccg caccggtgac attgtgcgct ggcgcgcagt acattccggt     20040
     gtgaccggca gcatgaccga cggcactttt cccggacatg cgatcgagta cctcggccgc     20100
     tccgaccatc aggtcaaggt tcgtggactt cgtatcgaac tcggcgagat cgatgccgcc     20160
     ctcaacgcac atcccgatgt cgaattcgct gccaccctgg gctacgagtc gcccgcggaa     20220
     acccgactgg catcgcacgt gctggtcggt gcgggcgccg accgtgatcc ggcagctctg     20280
     ctcgcgtttc tgcgtcaggc attgccggga tacatggttc cgtcggcgct cgtgttcctg     20340
     gacacgattc cgctgacccc gaatggcaaa ctcgaccggg acgccctgcc cgcgcccgac     20400
     ttcggtgcgg cagccaagga gatcgtgtac cgggaaccgc ggaaccccct ggagcagtcg     20460
     atcgcggatg cgtttgccga agtgctgggc ggtacggaca tcggtctcga cacggatttc     20520
     ttcgatgcag gcggtaactc gctctccgcg acccgggtga ccgcccgggt cggcgccctg     20580
     ctcgacatcc gggtcaccgt gcgtgatctc ttcgaagccc cgaccgtcct cgcgctggcc     20640
     gagtcgctgg cgccgcgaat gtccgaggcg ggcgacggcg cttccgccgg accggccctg     20700
     gcgccgcagc cgcgtcccga ccggatcccg ctgtcactcg cgcagcagcg gatgtggttc     20760
     ctcaaccagt tcgagacgtc ctcgcccgca tacaacctgc ctgccgcggt ccggctcacc     20820
     ggaccgctgg acacggcggc gctggccgcg gcgatcgatg atctgatcac ccggcacgaa     20880
     tcgctgcgga ccgtcttccc cgattcccgg ggcggaccgc accaggtgat cctcgagccc     20940
     ggacagttca cccccgacac cgcaccggtc cgcgtgagcg agagcggtct acgcgcggat     21000
     ctcgagcagt tcctgctgac cggcttcgac gtctcccagg ccgtgcccct gcgggtgaag     21060
     gtgtactcgc tcggcgacac cgagcacgtg ctcgctttcg tcgtccatca catcgccgcc     21120
     gacggcgtgt ccatggaacc gctgatccgg gacgtgatga tcgcgtactc gagccgcgcg     21180
     gcaggtcatg cgcccagctg ggcgccgctg ccggtgcagt acgccgacta cgcgctgtgg     21240
     cagcgggagg tgctcggcgt cgaatccgac ccgggcagcc tcgccgccgc ccagctcgag     21300
     tattggaccc ggacactcgc cggtgtcccg gaccagctgt acctgccggg ggaccggggc     21360
     aggccggccg ttccgtcgca tcggggtgcg gcaacgcgtt tcaccctgga cgccgacacg     21420
     caccgggccc tggccgagct ggcacgcgcg cacggcgcca gcatcttcat ggtcgcccac     21480
     gccgcgctca gcgtcctgct gggccggctc agcacgagct ccgacatcac cgtcggcacg     21540
     gcgatcgccg gtcgcggccg ggtggaactc gacgacatca tcggcatgtt cgtcaacacc     21600
     ctcgtgttgc gcacgacgct ggacccgggg gcgtcgttcg tgtcgctgct cgaacaggcc     21660
     cgggacgtcg acctcgaggc gttcgcccac gcggacctgc cgttcgagcg gctggtggag     21720
     gttctcagcc cggtccgctc cacctcgcac cacccgctgt tccaggtggc gctcggcgtg     21780
     caggcggtct ccgccgaccg actcgaactg gacgggctgt cgctggagcc gctcaccctc     21840
     gacgcgagca ccgcgaagtt cgacctgcac ttcacgctca ccgagcggct cgacgacgcc     21900
     tccgaggccg ccggcatcga cgccgaactg gtttacgcga cagacatttt cgacgagagc     21960
     accgccgccg agtacgcgat ccggctgcgg cggatcttcg aggcggtcgt cgccgacccg     22020
     cagcggccga tcggtgacat tccggtcctc ggcgacgagg aatacgcggc gctcaccccg     22080
     gtgcgcggcg ccgacgcgcg acctgtgcag atgctgcccg agatcctcgc cgacgccgtc     22140
     gccgcggcac ccgacggacc cgccgtcgtc ttcgaggggg agagcctcac gtaccgggac     22200
     ctcgacgaac ggtcgaacca gctggcccgg ttgctcgtcg acaggggagt gggacccgaa     22260
     acccgggtcg cgctggcgct gccgcggtcc ctcgaatccg tggtggccgt gtgggcggtg     22320
     gccaagaccg gtgcagcctt cgtgcccgtc gaccccggtt atcccgcgga ccgggtcctg     22380
     cacatggtgc aggactccgg ggcgatggtc gggatcaccg tgtccgcgaa acaggacgtc     22440
     ctcccggact cgatccggtg gatgctgctc gacgacccgg cactcgcggt gcgctgcacc     22500
     cacgaatccc ggttgccgct gaccaaccgc gaccgcatgc ggccgatcct gtccgaccag     22560
     gtggcgtacg tcatctacac gtcggggtcc accggccggc ccaagggagt cgcggtcacg     22620
     catcgcggtc tgatgaacct ggtgaccgac gagcgtgagc tcctcggggt cacctccggc     22680
     tcgcggacac tgcatttcgc gtccccgagc ttcgacgcct cggtgttcga gatgctgatg     22740
     gcactcggcg cgggagccac gatggtcatc gccccgccca cgatctacgg cggatcggaa     22800
     ctcgcggaac tgctcgccgc ggaacacgtc acccatgcgt tctccactcc ggcggcgctg     22860
     gcgtcggtgg accatcacgg gctcgacgac ctcgccgtgg tcgtggtcgc cggtgacgtg     22920
     tgcccaccgg aactggtcgc ccgctgggcg cccgggcgtc gcatggtgaa cgcgtacggc     22980
     cccagcgagg cgacgatcat gtcgtccatc accgaacccc tccgcgccgg cgaaccggtc     23040
     accatcggtg gcccgagccg cggagtgcgg gcactcgtgc tggacggccg gctgcgcccg     23100
     gtgccggtgg gtgtgccggg cgaactgtac gtcggaggac cgagcctcgc ccgcggctac     23160
     ctgggacggc cgggactgac cgccgaacgc ttcgtcgccg acccgtacgg cgagcccggc     23220
     gacctgatgt accgcaccgg cgacctcgtc cggtggcggg agaaccgcgt cctcgatttc     23280
     gtcggccgca ccgaccacca ggtgaagatc cgcggattcc ggatcgaact cggcgagatc     23340
     gatgccgcgc tcaccgcaca cccgcagatc gagtacgcca ccacgatcgg gtacgagcac     23400
     ccgaacgggg agacctccct cgtcgcgtac gtgctgccgt tcaccggtga ggacgtggac     23460
     cgggtcgagg tcgcgaactt cgtcgggcgc accctgcccg cctacatggt tcccgcctcc     23520
     gtcacgctcc tcgacgccct gccgctcacc ccggcgggca agctcgaccg ggccgcgctg     23580
     cccgagccga tcttcgtcgc cgcggccacg acattcgagg caccgcggaa cccgatggaa     23640
     gtgatcgtcg ccggcatctt cgcggacatc ctcgcgttgc ccgagatcgg catccacgac     23700
     agcttcttcg acctcggcgg caactcgttg ctcgccaccc aggtggtgtc gcggatcaac     23760
     gccgcactcg acgtccacgt cggggtccgt gaagtgttcg agtcgccgac cgtcgccgca     23820
     ctcgcggcac gcatcaccga gaccaccacc cacggtgtgc gacgccccgc gctgacggcg     23880
     aagccccggc ccgagcacat tccgctgtcg ctcgcccagc agcggatgtg gttcatcaac     23940
     cagttcgaca ccgcatcgcc cgcctacaac ctgccggtcg cgctccggct gtcgggcgag     24000
     gtggacctgc gtgccatgca gatcgcgatc gccgatctcg tcgggcggca cgaggcgctg     24060
     cgcaccgtct atcccgactc cgtcgacggt ccgcaccagg tgatcgtgcc cgccggggac     24120
     gcggtgcccg acctgacacc ggtggcggcg caccccgacg acgtcctcga ccgggtgctc     24180
     gcactcgtca cgacgggctt cgacgtgacc gcggacgtgc cgctgcgggc gcggatgtac     24240
     cgcgtcggcg ccgacgacta cgtgctcgtg atggtcgccc accacatctc gggtgacggc     24300
     tggtcgctcg ccccgctggc ccgcgacgtc atgctcgcct acaccgcccg cgccgaggga     24360
     cacgttcccc gctggacgcc gctgccggtg cagtacgccg actacagcct gtggcagcgg     24420
     gaactcctcg gcgacgagac cgatcccgaa tcggtcgccg ctgctcagat cgcctactgg     24480
     actcgcacgc tggagggtct gccggaccgg ccgtccctgc cgaccgaccg tccccgcccc     24540
     gcggtcgcgt cgcacctggg cgcgcacgtg ccgttcacca tcgacgccgg cacccaccgc     24600
     gccctgctgg cgctcgcacg cggccggaac acctccctgt tcatggtgat gcacaccgcg     24660
     ctcgcggtgc tgctcgcgcg actgagcaac gagtccgaca tcgccgtcgg cgcacccatc     24720
     gccggccgcg gtgaggaatc cctcgacgaa ctcgtcggca tgttcgtgaa caccctggta     24780
     ctgcgcaccc gggtggccct cgcgagttcg ttcgcggaca gcctcgccga cgtacgctct     24840
     gccgatctga atgcgttcgc gcactccgac attccgttcg agcgcctcgt cgacgtgctg     24900
     aacccggccc ggtcccgcgc gcaccacccg ctgttccagg tcgcgttctc gttccagaac     24960
     ctcgccacca ccacactcga acttcccgga ctgcacgtcg agggactcga cgtgccgaac     25020
     acgatctcca acttcgatct gcacctgaca ttgtcggaga agcacgacgc cgacggatcc     25080
     ccggacgtga tcgaggcaca gttcacctac gccaccgacc tcttcgacga atccaccgtg     25140
     cgggcgttcg cggaacgctt cacccgcgtg ctcgcgtcgg tcgtggagga tccggacgtg     25200
     gccgtcgggg ccatcgacct cctcgacggc cccgaacgac agtcgatcgt cgccgacttc     25260
     aacgacaccg gcgtcgatct gccgccgacg acgctcgccg aactgttctc cgcccaggcg     25320
     gcgcgcaccc ccgagaaggc cgcggtgttc ttcgagggca ccgaactgac ctatgcggag     25380
     ttcgaccgcc gtgtcgacgt gctcgcccac cgcctgatcg atcgcggggt gggaccggaa     25440
     tccgtggtgg gactggcgat gaaccggtcg atcgaactgc tggtcgggat gtacgcggtg     25500
     ctgcgagccg gcggcgcgta cctcccgatc gatctcaccc atccggccga ccgcctcgcc     25560
     tacgtgctcg cgaccgcacg accggtgtgc atcctcacca cgtcctcgga cgggttcgcc     25620
     gccgagtccg tcccggtcat cgagatcgac accctcgacc acaccggctc accacgcgaa     25680
     ccggtgaccg atgcgcgtcg cctcgccccg ctgcggccgg agaacacggc gtacctgatc     25740
     ttcacgtccg ggtccaccgg ccggcccaag ggggtcgccg tgactcacgc cgccatcgcg     25800
     aaccaactcc gctggaagca gcacgaatac tcgctcgaca ccaccgacgc cgtcgtgcag     25860
     aagacacccg tcacgttcga cctgtcggtg tgggaactgt tctggccgct gaccacgggc     25920
     gcccgactcg tcatcgcccg cccggacggt caccgcgacc cggcctacct ggcggacctg     25980
     atgcgtcagc agcgcgtcac gacagcacat ttcgtgccgt ccctgttgga ggccttcctg     26040
     gcgacgccgg atgcggggga gcagccggcc ctgcggcggg tgctgtgcat cggcgaagcg     26100
     ctgcccgtcg acaccgccgc ccgcttccgc cgccggttcg ggaccgtcgc gctacacaac     26160
     ctgtacgggc ccaccgaggc cgccgtgtcc gtgaccgcat ggacacacac cgccgacgat     26220
     gtcgacaccg ttcccatcgg cggacccgag tggaacacgc aggtgttcgt gctggacgcc     26280
     cgcttgaacc cggtccccgt cggggtagcg ggtgagctgt atctcgccgg tgagcaactg     26340
     gcccgcggct acgtcgctcg cgcggatctg acggccgaac gcttcgtggc caaccccttc     26400
     ggcgcatccg gttcgcggct ctaccgcacc ggcgacgtcg tccgctggca cgtccgggac     26460
     agcaggggcg tcctcgagta cctcgagcgc tccgacttcc aggtgaaggt ccgcgggttc     26520
     cgcatcgaac tcggcgagat cgagtccgcc ctggtgtcga gcgcgggagt ggggcaggcc     26580
     gtcgtcgtcg cccaccagca cccgcacacc gggacgaccc tgatcggcta cgtcgtcccc     26640
     gaggacggtg ccaccgtcga cttcgccgcg gttctcgccg aggtcggcgc cgccgtcccg     26700
     agctacatgg tgcccgccgc cctcgtcgtg ctcgcgcaac tgcccctgac ctcgaacggc     26760
     aaactcgacc gcagggccct tcccgcaccc gacttcgcct cggcgacaga cgaatatcgt     26820
     gcccccgcga cgcccacgga ggaagcggtt gccgccgtgt tcgccgacgt gctcggcgtc     26880
     gaccaggtcg gtaccgcagc gaacttcttc gacctcggtg gcaactccct cgtcgccacc     26940
     cgggtggtcg cccgcctgtc cgagcggctc gggtgccgtg tggagattcg aaccctgttc     27000
     gaggcgccca ccgtcgccgc ccttgcggca ctactggatt cgatcgacgc caccgcaccc     27060
     gcccgcccgg cgctgacacc ggcggtgcgc cccgaacgga ttccgctgtc gtcggcgcaa     27120
     caccggatgt ggttcctcaa caggttcgac ccgaactccg cggtgcacaa cattcccgcg     27180
     gcggtccggc tgtcgggcgc gctggacgtc gacgcactgc agcatgcggt cgccgacgtc     27240
     gtccgcaggc acgagtcgct gcggacggtg tacccggact ccgcggacgg cccgcaccag     27300
     gtgatcctgc ccatcgaccg ggtggggggc gaaatgtccg tcgtcgcgac ggacgaggcc     27360
     gcgctgcccg ctctgatcgc cggcctggtg accaccggat tcgacgtcac cacggaggtt     27420
     ccggtgcggg tgcggatctt ccgcatgtcc gcgacggaac acgttctcgc cctggtggtt     27480
     catcacatct ccggcgacgg ctggtcgatg gccccgatgg tgcgggacgt gatgacggcg     27540
     tacgcggcgc ggtcggcgga caccacgccc gactgggcgc cgctgccggt gcagtacgcc     27600
     gactacgcgc tgtggcagcg ggcgcttctc ggcgacgaga ccgatcccga atcggtgtcg     27660
     gcacggcaac tcgcgttctg gacgcacacc ctcgcgggcg caccggatca gttggacctg     27720
     cccaccgacc gcccgcgtcc cgcggtcgcg tcgtaccggg gcggcaccgt cgacttcacc     27780
     gtgccggccg acctgcacgg cacgctcctg ggtgcggcgc gggacgcgaa cgcgtccctg     27840
     ttcatgctcg tgcacgcggc gctcgcggtg ctgctgagcc gactctccgg caccggggac     27900
     atcgccatcg gcacacccgt cgcgggccgt ggcgaacgcg aactcgacga cctgatcggc     27960
     atgttcgtca acacgctggt cctgcgccag caggtcgacg gaggccggac cttcgccgaa     28020
     ctggtcgccg acgtgcgcga gaccgatctc gccgccttct cccacgcgga cgtcccgttc     28080
     gagcgcctcg tggaggtcgt caatccgtcg cggtccaccg ggcggcatcc cctgttccag     28140
     gtgatgctca cgttccagaa cctcgaccag gcgacccttc gactgggtga cctgtcggtg     28200
     agcggcgtcg acttcgacgt cgacatcgcc aagttcgacc tgcagctcac cctgatggag     28260
     cagttcgact cggcgggaag tccggacggg atcgcggccc gcctcacgta cgcctccgac     28320
     ctgttcgacg agccgtccat gcacgtgttc ggacagcggt tccagcaggt tctccgggcg     28380
     gccaccgaca gtccggacac cgcggtcggc gacatcgacg tcctcggcag cggcgaacgg     28440
     aagcagatcg ccggcaccaa cgcgacatcg cacgaggtgc ccgccggcac cctggcgtcg     28500
     ctgttcgaca cgagggtcgc ggcggacccc gtccgcgtcg cggtgatctt cgaccgggac     28560
     gagttgacgt acgccgactt cgacgcccgc gtgaacaggc tggcgcgccg actgatcgag     28620
     cagggcgtcg gccccgagtc ggtggtggcg gtcgcgatgc gccgttcgat cgatctgctc     28680
     gtcgcgatct acgccgtcgt gaaggccggc ggcgcctacc tgccggtgga tccggaccac     28740
     cccgccgagc gcaccgcgca tgtactcgac accgcacagc cggcatgtgt gctggtcagc     28800
     ggtgccggac tcgccggcgg cggatcggtc cccgtcatcg acgtcgcgtc cgaggacgtc     28860
     tccggcttcg acagctcgcc cgtcaccgac gcggaccggc tgtggccgct gtccccggcg     28920
     aacacggcgt acgtgatctt cacgtccggg tcgacgggcc ggcccaaggg cgtcgccgtc     28980
     acccacggcg cgatcgtgaa ccgactgctg tggatgcagc acgaatacac cctgaccagt     29040
     gcggacgtcg tcctgcagaa gaccccggtg acgttcgacg tgtcggtgtg ggagctgttc     29100
     tggccgctgc aggtgggagc ctccctggtg atcgccgcac ccgacggaca ccgcgatccg     29160
     cggtacctga cagggctgat acaggaacgt cacgtgacga ccacccactt cgtaccgtcg     29220
     atgctgtcgg tgttcactgc cgaacctgct gtggcggtgt gtgattcgtt gcggttggtg     29280
     ttctgttcag gtgaggcgtt gacgccggag caggtgtcgc ggttccgggc ggtctgtggt     29340
     gccgatctgc acaatttgta cgggccgacg gaggccgcgg tcgatgtcac gtattgggag     29400
     accggtgcgg cggacacggt gacggtgccg atcgggcgtc cggtgtggaa cacgcaggtg     29460
     catgtgctcg attcgaggtt gcatccggtg ccgaacgggg tggcggggga gttgtatctg     29520
     gcgggcgatc agctggcgcg ggggtatctg aatcgtccgg atctgtcggc ggatcggttc     29580
     gtggcgaacc cgcacgtggc gggtgggcgg atgtaccgga cgggggatct ggtgcgtcgc     29640
     cgcgcggatg gggttctgga gtatgtgggg cgtaccgatt tccaggtgaa gttgcggggg     29700
     cagcggatcg agttggggga gatcgaggcg gcgctggagg cgcatccgga cgtgtcgcag     29760
     gcggtggtgg tggtgcaccg cgacgaccgc ggcgaggaag cgttggtggc gtacctggtg     29820
     ggaccgcgcg cggccgactg gtccgacgtg cgcgcacacc tgtccgcgcg cgtcccgtcg     29880
     tacatgatcc cggcccaggt cgtgcacctg gataccctgc cgctgtcggc gaacggcaaa     29940
     ctcgaccgca cggccctgcc cgcaccggcc gcccggtcgg cggccgacga gtaccaggcg     30000
     ccgcgaacgg cggccgagcg cgccgtcgcc acggtgttcg ccgacgtgct cggcatcgac     30060
     cgcgtgggag tcacggacag cttcttcgac ctcgggggca actcgctgat cgccacccgg     30120
     gtcgcatccg cgctcgggtc cgagctggga atcgacttcc cgctgcaatg gatgttcagc     30180
     gaccccacac cgcagtcgct gggacaacgc atccagaagt ggacgaacga cggggtggac     30240
     ggtgccggtg cgtcactcga cgtgcttctc ccgatccgca cgagaggaac ggcggagccg     30300
     ctgttctgtg tgcatccgtt catcgggctc gcctggagct acgcggggct cggccgcgag     30360
     ctgacccagg accggccgat ctacgggctg cagtcgcccg cgctgaccga ggacgaaccg     30420
     cacctggaga cgatcaccga cttcgcggcc cgctacgtcc gagagatccg ttcgatccag     30480
     ccgcacggcc cgtatcacct ggtggggtgg tcgctgggtg gagtcatcgc ccacgagatg     30540
     ggagtgcagt tgcaggatgc cggtgaagag gtgcgtctgc tggggctcct cgacagctac     30600
     gtcgggatcg accgcagcgt ggagaactcc gcgaccaccg cggatcttct cggcggtgtc     30660
     ggcctggacc tcccggacga cagcgtgctc gacgaactcg cgccggacgg acagttcgac     30720
     gccgagcgtg cggcggcact gctgcgggtc gtcggagggc cgctggcggc gctgaccgcg     30780
     acggaactcg aacggatcta cggcaatgcg ctgcgagccc ccgcactgat cgacgcgcac     30840
     cggccgaggg tcttcgacgg cgagctggtg ttcttcaccg ccgccctgga cgacggtttc     30900
     cacgtggacc cggtgacctg ctgggggcag ttcgtgcgcg ggagtatcga cgagcacccg     30960
     gtggacgcga cgcactggac gatgacgacg ccggatgctc tcgccgcgat cgcaccgcac     31020
     ctcgagcgtt cgcatcgccg gccgcggcac gccgcgcccg acaccggcag ggacagcgat     31080
     cccgacgaca gcgcgaaccg gccgcactcg gtgcgctga                            31119
//

If you have problems or comments...

PBIL Back to PBIL home page