(data stored in ACNUC7421 zone)

EMBL: CP000431.PE145

CP000431.PE145       Location/Qualifiers
FT   CDS_pept        complement(204228..204956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00145"
FT                   /product="dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0016410 - N-acyltransferase activity;
FT                   GO_function: GO:0016810 - hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolism; GO_process:
FT                   GO:0042158 - lipoprotein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91981"
FT                   /db_xref="GOA:Q0SKF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF5"
FT                   /protein_id="ABG91981.1"
FT                   /translation="MIIPTYNERENLGLIVGRLHAALPRTHVLVVDDGSPDGTGDVADA
FT                   LASSDDASRIHVMHRTEKNGLGAAYIAGFHWGLDRDYTVLVEMDADGSHAPEQLHRLLD
FT                   QVDAGADLVLGSRYVPGGTVVNWPKHREWLSRGGNIYSRLALGVKIKDITGGYRAYRRE
FT                   VLEKLDLAAVESHGYCFQVDLAWRAIQEGFDVREVPITFTEREIGESKMSGGIVREALL
FT                   KVTQWGLRNRIAKLKGAAAR"
     gtgatcattc cgacgtataa cgagcgggag aatctcggcc tgatcgtggg tcgcctgcat        60
     gcggcgctgc cgcggacgca tgttctcgtc gtcgacgacg gcagcccgga cggcaccggc       120
     gacgtcgcgg acgccctcgc gtcgagtgac gacgccagtc gcatccacgt gatgcaccgc       180
     accgagaaga acggtctcgg agccgcgtac atcgccggtt tccactgggg tctggaccgc       240
     gactacaccg tcctcgtcga aatggacgcg gacggcagtc acgcgcccga gcagttgcat       300
     cgcctactcg accaggtgga cgccggcgcc gacctcgtgc tcggttcgcg gtacgtgccg       360
     ggtggcacgg tcgtcaactg gccgaagcac cgtgagtggc tctcgcgcgg cgggaacatc       420
     tactcgcggc tcgcgctggg cgtgaagatc aaggacatca ccggcggata ccgggcgtac       480
     cgccgtgagg tgctcgagaa gctcgacctc gccgcggtgg agtcgcacgg ctactgcttc       540
     caggtggatc tcgcatggcg ggcaattcag gagggcttcg acgtccgcga agttcccatc       600
     acgttcaccg aacgagagat cggcgaatcg aagatgagcg gcgggatcgt tcgcgaggcg       660
     ctcctcaagg tcacgcagtg ggggctgcgg aaccggatcg ccaagctcaa gggtgcggca       720
     gcgaggtag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page