(data stored in ACNUC7421 zone)

EMBL: CP000431.PE146

CP000431.PE146       Location/Qualifiers
FT   CDS_pept        complement(204937..206640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00146"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0016410 - N-acyltransferase activity;
FT                   GO_function: GO:0016810 - hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolism; GO_process:
FT                   GO:0042158 - lipoprotein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91982"
FT                   /db_xref="GOA:Q0SKF4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF4"
FT                   /protein_id="ABG91982.1"
FT                   /translation="MSGSTTPRWTIGKLGVLVRSVLSVAAGFLVFAGFPPRPLWFLAPI
FT                   GIALLTLILTGAGGAAPRLRAGFGYGYLAGLGFLVPLLPWIGVFVGALPWLALAAVESL
FT                   YIGLFGVLAVLVSRLRWAPLWIAACWSLTEWLRASVPFGGFPWGRLAFGQSEGWFLPLA
FT                   SIGGAPLLSFAVALTGAGLASVAVTVRARASGATNWTRPLAGGLVAALAATVVSLALWP
FT                   TPPGMDSGDRTITVAAIQGSVPKLGLDFNDQRKRVLDNHVNRTLELADDVASGAAPQPD
FT                   LVVWPENASDIDPLRNADAAADISRASEAIGAPILVGAVLVNSDRTTTNSVIVWDGDAG
FT                   PQEQHDKKIIQPFGEYLPYRGFFRHFSAYADRAGNFVPGDGDGVVHADGIAVGVATCYE
FT                   VAFDRAFEQSVRSGAELLAVPTNNATFGDTEMTYQQLAMSQVRAVEHGRAVVVAATSGV
FT                   SAIISPDGSTAAETSLFVPAALVSQVPLRTGTTLASRLGPIPEVLLCVGAVAAVAFAVV
FT                   QRRRTVRTLIQRSTEKAPAVAGREDPHGIGDRFRAERGTERTDSGDHSDV"
     atgagcggta gcaccacacc tcgctggact atcggaaagc tcggcgtgct ggtgcgttcc        60
     gtcctgtcgg tggctgcggg attcctcgtg ttcgccggct ttccgccccg gcccctgtgg       120
     ttcctcgcac ccatcggcat cgccctgctg acgctgatcc tcaccggagc cgggggtgcg       180
     gcaccgagac tgcgcgcggg tttcggctac gggtatctcg cgggactcgg tttcctcgtg       240
     ccgctgctcc cgtggatcgg ggtgttcgtc ggagccctcc cgtggcttgc gctcgccgcg       300
     gtcgagtcgt tgtacatcgg actgttcggg gtgctcgccg tgctcgtctc ccggctccgc       360
     tgggccccgc tgtggatcgc ggcgtgctgg tcgctcaccg aatggctgcg cgcgagcgtg       420
     ccgttcggcg gcttcccctg ggggcgattg gcgttcggcc agtcggaggg ctggttcctg       480
     ccgctcgcga gcatcggcgg tgccccgctg ctcagcttcg ccgtcgcact gaccggcgcc       540
     ggactggcat ccgtcgccgt gacggtgcgg gcccgggcga gcggtgccac gaactggacg       600
     cggccgctcg caggcggcct ggtcgccgcc ctcgccgcga ccgtcgtgtc gctcgcgttg       660
     tggccgacac cgccgggcat ggactcggga gaccggacga tcaccgtcgc cgcgatccag       720
     ggcagcgtcc ccaagctcgg actcgacttc aacgaccaac gcaagcgggt cctcgacaat       780
     catgtgaacc gcaccctcga actcgccgac gatgtcgcgt cgggcgcggc gccgcagccc       840
     gacctcgtcg tctggcccga gaacgcgtcc gacatcgatc ccctgcgcaa cgccgacgcc       900
     gccgccgaca tctcccgggc gtccgaggcg atcggtgcgc ccattctggt gggcgcggtg       960
     ctggtgaact ccgaccgcac caccaccaac tcggtgatcg tgtgggacgg cgatgcggga      1020
     ccacaggagc agcacgacaa gaagatcatc cagccgttcg gcgagtacct gccgtaccgc      1080
     gggttcttcc ggcacttctc cgcgtacgcc gaccgggcgg gcaacttcgt tcccggcgac      1140
     ggtgacggcg tcgtccacgc ggacgggatc gccgtgggcg tcgcgacctg ctacgaggtg      1200
     gcgttcgacc gggcgttcga gcagtcggtg cgcagcggcg ccgaactgct cgccgtcccc      1260
     accaacaacg ccacgttcgg cgacaccgag atgacctacc agcagctcgc catgtcgcag      1320
     gtgcgggccg tggagcacgg ccgcgccgtc gtcgtcgccg cgaccagcgg tgtgagcgcg      1380
     atcatcagcc ccgacgggtc cacggcggcg gaaacctcac ttttcgtacc cgcggccctg      1440
     gtgtcacagg tgccgctgcg caccggtact acgctggcaa gtcggctcgg cccgattccg      1500
     gaggttcttc tctgtgtcgg cgccgtcgct gccgtcgcgt tcgccgtggt gcaacgacga      1560
     cgcacagttc gcacactgat tcaacgcagt accgagaagg cgccggcagt tgccggcagg      1620
     gaggatcctc atggcatcgg agaccgattc cgggcagagc ggggcaccga gcgcacggac      1680
     tctggtgatc attccgacgt ataa                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page