(data stored in ACNUC7421 zone)

EMBL: CP000431.PE147

CP000431.PE147       Location/Qualifiers
FT   CDS_pept        complement(206630..208234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00147"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91983"
FT                   /db_xref="GOA:Q0SKF3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF3"
FT                   /protein_id="ABG91983.1"
FT                   /translation="MPVTTQLLVGGRIYSSFAPDATSMAVTGGVVSWVGDDRAARALHP
FT                   GADVVDLGGAFVTPAFVDTHVHLTALGLNIVGLDLVGVGSLRECLDRLASFARTHGDAV
FT                   IWGHGWDESAWPEGAGPTTAQLDEAAPGRTVYLSRIDVHSAVCSTALRQSVPDLSDTAG
FT                   FSPEGPLTFEAHHAARTVARSLLTAEQRSAARTAALDAIASRGIVAVHECGGPDIAGLD
FT                   DFRELLATPHGVEVRGYWGEAVTDADEARKLLNATGAHALGGDLFIDGSLGSHTAWLSE
FT                   PYADLDGGTGKSYLGVDEIAAHVRACTIAGIQAGFHVIGDAAVRAAVDAFAVVAADLGG
FT                   PAVAKAGHRLEHVEMMTGDDAARLAQWGVIASVQPAFDALWGGTDGLYAQRLGTERALT
FT                   LNPFAAAASAGVSLALSSDAPVTPVDPWAMLRAAVHHRTPGSGISPRAAFSAATRGAWR
FT                   AGGVRDGLAGTLDPGAPASYAVWDAGELVVSAPKDSVQRWSTDPRSRVPALPRLEDDAP
FT                   TPVLLRSVHRGSVVHER"
     ttgcctgtga ctacacaact gctggtcggc ggccgaatct acagttcctt tgcaccagac        60
     gccacgtcga tggcagtgac cggcggcgtc gtgtcgtggg tcggcgacga ccgcgcggcc       120
     cgcgcgctgc atcccggcgc cgacgtggtc gacctcggcg gcgcgttcgt caccccggca       180
     ttcgtcgaca cccacgtgca cctcacggcg ctcggcctga acatcgtcgg gctcgatctg       240
     gtcggtgtcg ggtcgcttcg cgaatgcctc gaccggctcg cctccttcgc ccgcacccac       300
     ggcgacgcgg tcatctgggg acacggctgg gacgaatcgg cgtggccgga aggcgccggt       360
     cccaccacgg cgcagctcga cgaggccgca cccgggcgca cggtgtatct gtctcggatc       420
     gacgtccatt cggcggtctg ctcgaccgcc ctgcgacagt cggtcccgga tctgagcgac       480
     accgccgggt tctcgccgga ggggccgctg acgttcgagg cgcaccacgc cgcccgcacc       540
     gtcgcgcgct cgctgctgac ggccgagcag cgttccgccg cccgcaccgc cgcactcgac       600
     gccatcgcct cccgcggcat cgtcgctgtg cacgagtgcg gagggcccga catcgccgga       660
     ctcgacgatt tccgggaact cctcgccacc ccgcacggcg tcgaggtccg cggctactgg       720
     ggtgaggcgg tcaccgacgc cgacgaggcc aggaagttgc tgaacgccac cggcgcccac       780
     gcgctgggcg gcgacctgtt catcgacgga tccctcggct cccacacggc gtggctcagc       840
     gaaccctatg ccgatctgga cggcggcacc ggcaagagct acctgggagt cgacgagatc       900
     gccgcccacg tgcgggcctg cacgatcgcc ggaatccagg ccgggttcca cgtcatcggc       960
     gacgccgccg tccgggccgc ggtcgacgcg ttcgccgtcg tcgccgccga cctgggcggg      1020
     cccgcggtcg cgaaggccgg gcaccgactc gaacacgtcg agatgatgac cggggacgac      1080
     gcggcgcggc tcgcgcaatg gggtgtgatc gccagcgtcc agcccgcgtt cgacgccctg      1140
     tggggtggca ccgacggcct gtacgcgcag cgcctgggaa ccgagcgtgc cctcaccctc      1200
     aacccgttcg ccgccgccgc ctccgccggg gtgtcgctgg cgctgagctc cgacgcgccc      1260
     gtcaccccgg tcgacccctg ggcgatgctg cgcgcggccg tccatcaccg cacccccggc      1320
     agcgggatct ccccccgcgc ggcgttctcg gcggccaccc ggggtgcatg gcgggcaggc      1380
     ggggtccgag acggtctcgc cgggacgctc gacccgggag cgcccgcgtc gtacgccgtg      1440
     tgggatgccg gggaactcgt cgtcagcgcg cccaaggact ccgtgcagcg gtggtcgacc      1500
     gatccccggt cccgggttcc ggccctgccg cggctcgagg acgacgcgcc cacaccggtc      1560
     ctgctgcgtt cggtgcaccg ggggagcgtc gtccatgagc ggtag                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page