(data stored in ACNUC7421 zone)

EMBL: CP000431.PE148

CP000431.PE148       Location/Qualifiers
FT   CDS_pept        complement(208247..208753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00148"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91984"
FT                   /db_xref="GOA:Q0SKF2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF2"
FT                   /protein_id="ABG91984.1"
FT                   /translation="MYAALFLLYVVVEIAALVLVGHAIGVLWTVLLLLGGTLIGLLLMR
FT                   SQWRRVMDGLRRAASGDGSPGAAVADGALVALGSALMFVPGLVTSVLGLLFLVPPTRWA
FT                   LRPVVVLLAGRRAATVAAGAEAFARAPRRGRGEVIEGEVVDEVFEGEVIDEEPRTPTRD
FT                   PHVLP"
     atgtacgccg cactgttcct gttgtacgta gtggtggaga tcgccgcgct cgtcctggtc        60
     ggtcacgcga tcggcgtgct gtggaccgtg ctcctcctgc tcggtggaac gctgatcgga       120
     ctgctgctga tgcggtcgca gtggcgtcgt gtgatggacg gcctgcgccg ggcggcgagc       180
     ggcgacggct ctccgggtgc cgcggtcgcg gacggcgcgc tcgtcgcact gggctccgcg       240
     ctgatgttcg tccccggcct ggtcacgtcg gtgctcggtc tgctcttcct cgttcccccc       300
     acccggtggg cccttcggcc cgtcgtggtc ctgctggcag gccggcgtgc cgcgaccgtc       360
     gcggccgggg cggaggcctt cgcgcgggca ccccgacgcg gtcgcggcga ggtgatcgaa       420
     ggggaggtgg tcgacgaggt cttcgagggc gaagtgatcg acgaggaacc ccgaaccccg       480
     acccgtgatc cccacgttct gccctaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page