(data stored in ACNUC7421 zone)

EMBL: CP000431.PE149

CP000431.PE149       Location/Qualifiers
FT   CDS_pept        208958..209575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF1"
FT                   /protein_id="ABG91985.1"
FT                   /translation="MTRSTVFRRAAIVLASAAAFGMLSTGPASAAPVADFAKGAAELQA
FT                   LATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVTLA
FT                   SAQGGPNLFPQISPNQLRFQAVPAYVAIPQSSDLSVAWINLTTFQGGIVKLDDKLPLIN
FT                   TPLLSKVVDTGKGTVLATMFGTVGYADSVTCTVVPTVGTFTV"
     atgactcgtt ccaccgtctt ccgccgagcc gcaatcgttc tcgcgtccgc agccgccttc        60
     ggcatgctgt ccacgggacc ggcatcggca gcaccggtcg ccgacttcgc gaagggtgcc       120
     gccgaactgc aggcgctggc caccgaggtc tcccccgccg cgaccgccgc cgtggacgcc       180
     cttctcggcg ccagcgtgtt catcccgaag gacgtgctcg aggtcggact caccacacca       240
     caggacttca tgtacccgtc ccccaccctc gggtgcggcg tcgccgacaa gcccgcgacg       300
     gtcacgctgg cgagcgccca gggcggaccg aacctctttc cccagatctc cccgaaccaa       360
     ctccgattcc aggccgtccc cgcctacgtc gcgatcccgc agtcgtccga tctcagcgtc       420
     gcctggatca acctcacaac gttccagggc gggatcgtca agctcgacga caagctgccg       480
     ctcatcaata ccccgttgct gtccaaggtc gtcgacaccg gcaagggaac cgttctcgcg       540
     acgatgttcg gcacggtcgg ctacgccgac tccgtgacgt gcaccgtggt cccgaccgtc       600
     ggcaccttca ccgtctag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page