(data stored in ACNUC7421 zone)

EMBL: CP000431.PE152

CP000431.PE152       Location/Qualifiers
FT   CDS_pept        complement(210849..211175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91988"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE8"
FT                   /protein_id="ABG91988.1"
FT                   /translation="MTCVLLAEFAHRGRPSADLHLLHQILLGERILREQACDGVLVLGV
FT                   DDEQRTVAIGEGAGRAHHLAADEFGEPPTMLRPVIVAEGRRLGAVRVFHDEQGHEVLVQ
FT                   PWSM"
     gtgacgtgcg tcctactcgc tgaattcgcc catcgcgggc gtccatccgc ggatctgcac        60
     cttctgcacc agattctcct gggcgaacgg atcctgcgtg aacaggcgtg cgacggcgtc       120
     ctcgtcctcg gcgtcgacga tgaacagcgc accgtggcca tcggcgaggg ggccggtcga       180
     gcgcatcacc ttgcggcgga cgagttcggt gagccaccca cgatgctgcg tccggtgatc       240
     gtcgcggagg gacgacgtct cggggctgta cgtgtattcc acgacgaaca gggccatgag       300
     gttctcgttc agccgtggtc gatgtag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page