(data stored in ACNUC7421 zone)

EMBL: CP000431.PE154

CP000431.PE154       Location/Qualifiers
FT   CDS_pept        212195..213754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91990"
FT                   /db_xref="GOA:Q0SKE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE6"
FT                   /protein_id="ABG91990.1"
FT                   /translation="MSTGLLNEPLERSAPPPVPRPFRAPMILAASGAVVAAVLFWIVSG
FT                   SLTDDAYISLSAARNLAVHGEWAIVHGLTANTSTSPLNVLVLGALTFLTRLWGPGDPLL
FT                   ALGMLNVAVTALLGWVLARMCRRLGLGSGWAVLAGALVVFNPFVLSAVGLEVLLIPAAV
FT                   AVMVWFAVEGRTAWFGAAAGMATLVRLDLLVFVVVIAALSPVIRTQLRRALAGFAAIAG
FT                   PWYLFSWVVLGSALPDTFLIKQGQASDVGGYNYLTGPIMYFESNPWRTVAAFGPAALAL
FT                   VLILVALASYARPWKRPVPVPVPLLALGLSGALYYVAYVVLDTVPYHWYYVAPATTLAM
FT                   FAVLAAGIHWSAARDTPDRAVAGSLAGLLAVLGVGAVYYDVESGLPWDAPPIFGNWASA
FT                   QDYERVGRAVGTLVGEAPVRSPGEIGTLAYFCECVIVDEFSDRGLVVEDRLVPRLAEAT
FT                   EPARTLLRANYVFFDYRLAPVNPAFDLRYEEGRGPGGPMSWDVFSAARGAGHFILVPLT
FT                   AG"
     gtgtccacag gattgctgaa cgaaccgctc gagcggtctg ccccgccacc ggtaccgaga        60
     ccgttccggg cgccgatgat cctcgccgcg tccggcgcgg tggtggccgc cgtgttgttc       120
     tggatcgtct ccggcagcct gaccgacgat gcctacatca gtttgtcggc cgccaggaat       180
     ctcgccgtcc acggggagtg ggcgatcgtc cacggcctga ccgcgaacac gtcgacgtcc       240
     ccgctcaacg tgctcgtgct cggggcactg acgttcctga cccggttgtg gggcccgggc       300
     gatcccctgt tggcactcgg aatgctcaac gtcgcggtca cggccctgtt gggctgggtg       360
     ctggcgcgga tgtgccggcg gctcggcctc gggtccgggt gggcggtgct cgccggcgcg       420
     ctggtggtgt tcaacccgtt cgtgttgtcc gcggtcgggc tcgaggtgct gctgatcccg       480
     gcggccgtcg cggtgatggt gtggttcgcg gtcgagggca ggaccgcctg gttcggtgcg       540
     gccgcgggga tggcgacgct ggtgcgtctg gacctgctcg ttttcgttgt agtcatcgcc       600
     gccctgtcac cggtgattcg cacgcaactg cgccgcgccc tcgccggctt cgccgcgatc       660
     gccgggccgt ggtacctgtt cagctgggtc gtcctcggtt cggcgctgcc cgacaccttc       720
     ctgatcaagc agggccaggc ctccgacgtg ggcggctaca actatctcac cggcccgatc       780
     atgtacttcg agtccaatcc atggcggacc gtggcggcat tcggtcccgc ggccctcgcg       840
     ctcgtgctga ttctcgtcgc gctcgcctcg tacgccagac cgtggaagcg accggtgccg       900
     gtgcccgtgc cgctgctcgc gctcggcttg tccggtgccc tctactacgt cgcctacgtc       960
     gtgctcgaca ccgtgccgta ccactggtat tacgtggcgc cggcgaccac gctggcgatg      1020
     ttcgccgtcc tcgccgccgg catccactgg agcgccgcgc gcgacacccc ggaccgcgcc      1080
     gtcgccggct cgctggccgg cctcctcgct gtgctgggag tcggcgccgt gtactacgac      1140
     gtcgagagcg gtctcccgtg ggacgcgccg cccatcttcg gtaactgggc gagcgcgcag      1200
     gactacgagc gggtcggccg ggcggtcggg acactcgtcg gggaggcgcc ggtgcgatcc      1260
     cccggtgaga tcgggaccct cgcgtacttc tgtgagtgcg tgatcgtcga cgagttctcc      1320
     gaccgcggat tggtggtcga ggaccggttg gtgccccgtc tcgcggaggc caccgaaccg      1380
     gcgcgaacgt tgctgcgcgc caattacgtc ttcttcgact accggctcgc acccgtgaac      1440
     ccggcgttcg atctccggta cgaggaaggc cgtggtcccg gcggtcccat gtcctgggac      1500
     gtgttctccg ccgcccgcgg agccggtcac ttcatcctgg tgccgctcac cgccggctga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page