(data stored in ACNUC7421 zone)

EMBL: CP000431.PE155

CP000431.PE155       Location/Qualifiers
FT   CDS_pept        complement(213835..214500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91991"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE5"
FT                   /protein_id="ABG91991.1"
FT                   /translation="MSNQYRCRSLIFARRQPAQMHGAFAVVEHSDRLAQRVPGIVELRA
FT                   IGDLSRESIEPTCRQPKSNPWVPTDVPHPAGDEIRARHRQRGWQKRDEVGTVTALDHPH
FT                   TLSSLFARLASSRRQYCKSRRRAHEEAGQHQGTEDCPVPRPPHQAPVLGRLLRRRSADL
FT                   PVPLVIIRRGRSILVSCHSHRPVPAFPASNMATVHRSTRRHFTCQATKNRAPCRSSGS"
     gtgtcgaacc agtaccggtg tagatccttg atcttcgcgc gtaggcaacc cgcgcagatg        60
     cacggcgcat tcgccgtagt cgaacacagt gaccgtctcg cacagcgcgt cccgggcatc       120
     gtcgaactcc gcgcgatcgg tgatctctcg cgcgagtcca tcgaaccaac ctgccggcaa       180
     ccgaagtcga acccgtgggt tcccacggat gttccacacc cagccggcga cgaaatccgg       240
     gcgcgtcatc gccaacgcgg gtggcagaag agagacgagg taggcacggt caccgcgttg       300
     gatcacccgc acacactttc gtcgctgttt gcccggcttg cgtccagtcg tcgtcagtac       360
     tgcaaatccc gtcggagggc gcacgaggaa gccgggcagc atcagggcac tgaggactgc       420
     cccgttccga ggcctccgca tcaggcgccc gtgcttggac gcctcctccg ccgccgcagt       480
     gcggaccttc cggttccgct cgtgatcatc cggcgcggcc gatcgattct cgtcagctgc       540
     cactcgcatc gccccgtccc agcgttcccc gcgagcaata tggcaacggt tcaccgttcc       600
     acgcggcggc atttcacgtg tcaggcgacg aagaatcgcg cgccgtgtcg tagcagcggg       660
     tcgtag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page