(data stored in ACNUC7421 zone)

EMBL: CP000431.PE156

CP000431.PE156       Location/Qualifiers
FT   CDS_pept        complement(214594..215322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00156"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0016566 - specific
FT                   transcriptional repressor activity; GO_process: GO:0006355
FT                   - regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0016481 - negative regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91992"
FT                   /db_xref="GOA:Q0SKE4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE4"
FT                   /protein_id="ABG91992.1"
FT                   /translation="MAKQVVSDSSRKRRRPTKQGAVLSEQLIMETALRLLRHHGSAGLS
FT                   VRRLGAALGADPSTLYRYFRGIDDLTLAIADELIGRSFHGWEPTGDWWRDLHSLGIRSH
FT                   AAYLDHPQAAVLSASRVSGRTSEKAAVDTILGVLREAGFPDGAAVRLYRAFVDQMLAFA
FT                   ALDGAELALPDDVRESDRQLWRSSYAQLPAETHPHIAATAGLLVDLSDRSAYPDALELL
FT                   LDGARALLHRLDAKRESATS"
     atggcgaagc aggtggtgtc ggactcgtcc cggaagaggc gcaggccgac gaaacagggc        60
     gcagttctct cggagcagct gatcatggag acggcgctgc ggctgctccg gcaccacggc       120
     agtgcgggcc tgtccgtccg ccgactcggg gctgcgctcg gggccgaccc cagcaccctg       180
     taccggtact tccggggcat cgacgacctg acgttggcga tcgccgacga gctgatcgga       240
     cggtctttcc acgggtggga acccaccgga gactggtggc gcgacttgca ctccctcgga       300
     atacgctcgc atgcagcgta tctggaccat ccacaggcgg cagtcctgtc ggccagccgc       360
     gtcagcggtc gcacctcgga gaaagcggcc gtcgacacga tcctcggggt actgcgcgag       420
     gcggggttcc ccgacggcgc agcggtgcgc ctctaccgcg cgttcgtcga tcagatgctg       480
     gcgttcgccg ccctcgacgg agccgaactc gcactacccg acgacgtccg cgagtccgac       540
     cggcaactgt ggcgatcgtc ctacgcgcaa ctgcctgccg agacgcaccc gcacatcgcc       600
     gcgaccgcgg gcctgctcgt cgacctctcc gaccgcagcg cctatcccga cgcactcgaa       660
     ctgctcctcg acggcgcgcg cgccctgctt caccgactcg acgcgaagcg agaatcggca       720
     acctcgtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page