(data stored in ACNUC7421 zone)

EMBL: CP000431.PE157

CP000431.PE157       Location/Qualifiers
FT   CDS_pept        215391..217022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00157"
FT                   /product="amino acid transporter, APC family protein"
FT                   /note="tc: 2.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0005279 - amino acid-polyamine
FT                   transporter activity; GO_process: GO:0006865 - amino acid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91993"
FT                   /db_xref="GOA:Q0SKE3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE3"
FT                   /protein_id="ABG91993.1"
FT                   /translation="MSQAGSEAPGRGHETPDRRVASRPSPPSSESDAHMAVVNNGAADA
FT                   PRATALRKSLGVMDGVAIAASSTAATTSIGVGLGVIAAVVGLQMPVVLLLAFVPILGIA
FT                   SGYARLNRVEPNCGNSYVWVGRSLSPWLGFLTGWMAIVAVVVFMAYTTAIAGSAILQLA
FT                   GMAGLHSIGGLALDPDSTLQSTMLGLTILGAVTFTAVRGVAVAARLQKYLLVFEYVVLI
FT                   GFCTYGLFAGSQPFSLSWFNPFAIPSFAVLAEGMVIAVFFYWGFEAAFSVSEEVRDPRD
FT                   ASRAGVITVFLVLGLFLLGAVAFQRVLTPTELADNGTVGLAFLGEALARQPLAALPVVA
FT                   LMFSVIASLQATVIPSARGLFAMGRDRTLGPVWTRIHSRYGTPAAGTVLLGGISAVVAL
FT                   LATVIPKLSDLLGAGISSIGLVVALWYGLTALAAAVRFRGLLRERPWEGLRAVVFPALS
FT                   ALVLLALGGYLGWIFYTSADHLEFSATNGWFQLLFPVLILISGLVVAAHAKWVRRSPYF
FT                   VTGRGTDADDVNLLGAPADVPVTTRS"
     atgtcacagg cagggagcga agccccaggc cgcgggcacg agacaccgga ccggcgcgtg        60
     gcctcgcgtc cctctccacc ctccagcgaa agcgacgcac acatggcagt agtgaacaac       120
     ggcgcggccg acgcgccgag ggcgacggcc ctccgcaaat ccctcggcgt catggacgga       180
     gttgcgatcg ccgcctcgag taccgccgcg acgaccagca tcggtgtcgg tttgggagtc       240
     atcgccgccg tggtcggcct ccagatgccg gtagtgctgc tactggcctt cgtcccgatc       300
     ctgggaattg ccagcggata cgcccggctc aaccgggtcg aaccgaattg cggcaacagc       360
     tacgtctggg tgggccgcag tctcagtccg tggctgggct tcctcaccgg gtggatggcc       420
     atcgtcgccg ttgtcgtgtt catggcctac accaccgcga tcgccgggtc ggcgatcctg       480
     caactcgccg gcatggccgg gctgcacagc atcggcgggc tcgctctcga tcccgactcc       540
     acgctgcagt cgacgatgct ggggttgacg atcctcggtg cggtgacctt caccgccgtc       600
     cgcggcgtcg cggtcgccgc acggctgcag aagtatctcc tcgtcttcga gtacgtcgtg       660
     ctgatcggct tctgcacgta tgggctgttc gccgggagcc agccgttctc cctctcctgg       720
     ttcaatccct tcgcgattcc gtcgttcgcc gtgctggccg agggaatggt gatcgcggtc       780
     ttcttctact ggggtttcga agcggcgttc agcgtgagcg aggaggtgcg cgatccgcgc       840
     gacgcgtccc gcgccggcgt gatcaccgtc ttcctggtcc tcggcctgtt cctgctcggt       900
     gcggtggcgt tccagcgcgt cctcaccccc acggaactgg cggacaacgg gaccgtcggg       960
     ctcgcgttcc tcggcgaggc actcgcccgt cagccgctgg ccgcgcttcc cgtggtggcg      1020
     ttgatgttct ccgtcatcgc ctcgctccag gccaccgtga tacccagcgc gcgtggactg      1080
     ttcgcgatgg gccgggaccg cacgctcggc ccggtgtgga cccgcatcca ttcccgctat      1140
     ggaaccccgg cggccggaac cgtgctgctc ggcggcatct ccgccgtggt cgcgctgctg      1200
     gccacggtca tccccaagct cagcgacctt ctcggtgcgg gcatcagttc gatcggtctg      1260
     gtggtcgccc tctggtacgg cctgacggca ctcgccgcag ccgtccggtt ccgcggactc      1320
     ctgcgggaac gtccgtggga gggactgcgc gcggtcgtgt ttcccgctct cagcgccctg      1380
     gtgttgctgg cattgggcgg ctacctgggc tggatcttct acacctcggc agatcatctc      1440
     gaattcagcg cgaccaacgg ttggtttcag ctgctgttcc cggtcctcat cctgatctcg      1500
     gggctggttg tggccgcgca cgcgaagtgg gtccgacggt cgccctattt cgtcaccggc      1560
     cgcggaacgg atgccgacga cgtcaacctg ctcggtgcgc ccgccgacgt tcccgtgacc      1620
     acccgttcct ga                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page