(data stored in ACNUC7421 zone)

EMBL: CP000431.PE159

CP000431.PE159       Location/Qualifiers
FT   CDS_pept        218855..219259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE1"
FT                   /protein_id="ABG91995.1"
FT                   /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLDQADSQIPW
FT                   TGVFADFARSPRGAAKPETAGETGDGVWAIYTLDDEGVARVEQVYATELDALRAHKHNT
FT                   DPHRSVRFLPYGVTVSVLDQPEEAAPPETE"
     atgggcgaca acaggccgtt cgggttcgac cccgacgatc tcgaccgcgt gatccgtgag        60
     gccggcgagg aattgcaggg cgtcaaggac cggatcgtca ggttcctgga ccaggcggat       120
     tctcagattc cgtggacggg cgtgttcgcg gacttcgccc gctctccgcg cggcgcggcg       180
     aagccggaaa ccgccggcga gaccggtgac ggtgtgtggg cgatctacac gctcgacgac       240
     gagggcgtcg cacgcgtcga gcaggtgtat gccaccgaac tcgatgcgct ccgcgcgcac       300
     aagcacaaca cggatcccca ccggtcggtg cggttcctcc cctacggcgt caccgtcagc       360
     gtcctcgacc agccggagga agcagcgcca ccggagacgg agtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page