(data stored in ACNUC7421 zone)

EMBL: CP000431.PE16

CP000431.PE16        Location/Qualifiers
FT   CDS_pept        25986..26459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91852"
FT                   /db_xref="GOA:Q0SKT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT4"
FT                   /protein_id="ABG91852.1"
FT                   /translation="MSTVSGLPAHVLLVHFIVVLAPLTAVLIVVCSVWPAARRRLVWLT
FT                   LVLAAVTVIVTPLTTDAGEWLEKHVARSSAVHTHAELGDSMIYFSVALLLSALAVTAVQ
FT                   LRERKSDPPRSLTVIVAVLAVVVAVGTIVQVYRIGESGSRATWGDVVTSGSEP"
     atgtcgactg tcagcgggtt gcccgcccat gtcctgctcg tccatttcat cgtcgtcctg        60
     gcaccgctga ccgcagttct gatcgtcgtg tgcagcgtat ggccggcggc ccgccgtcgg       120
     ctggtgtggc tcacgctcgt gctcgcggcc gtgacggtga tagtgactcc actgaccacc       180
     gacgccggtg aatggctgga gaagcacgtc gcccggtcgt ctgccgtgca cacccacgcc       240
     gaactgggcg acagcatgat ctacttctcc gtcgcgcttc ttctcagcgc gttggcggtc       300
     accgccgtcc agcttcgcga acgaaagtcg gatcctccgc ggtcgctcac cgtgatcgtt       360
     gctgttctcg cggtggtggt tgcggtaggg accattgttc aggtctaccg catcggagag       420
     tccgggtcgc gcgccacgtg gggggatgtc gtcacgtcgg gctcggagcc gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page