(data stored in ACNUC7421 zone)

EMBL: CP000431.PE160

CP000431.PE160       Location/Qualifiers
FT   CDS_pept        complement(219270..220439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00160"
FT                   /product="receptor-like histidine kinase of 2 component
FT                   system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0007600 - sensory
FT                   perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91996"
FT                   /db_xref="GOA:Q0SKE0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE0"
FT                   /protein_id="ABG91996.1"
FT                   /translation="MHMRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQL
FT                   VMGFLLCLPIVWRRKYPLAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVALYTLV
FT                   AYVDRSTAAVYAVGLVVDSALSIWLLEQELVAAGLFSVLVFALSWITAEFLGARRAYDE
FT                   EVAARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALKTNPD
FT                   IAKQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGLPVE
FT                   LELTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEITDNGN
FT                   SSGQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
     gtgcacatgc ggaggttcag tctgtggctg cgaggaaagc cgacggttgc ggactcgatg        60
     ctggcggcga tcctgttcac cctcgaggtg ttcgtgttca ccgcgtcggg cgaccgctcg       120
     ccgtgggtgc agctggtcat gggtttcctg ctgtgcctgc cgatcgtgtg gcgtcgcaag       180
     tacccgctgg cggcggccgg tgccgttctc gtgatgtcga tcacgatcac cttcatcagt       240
     tattcgatcg gtgacctcga cgccgaacat cccggtctgc tggcgctcgc cgtcgccctc       300
     tacacgctcg tcgcctacgt cgaccgcagc accgccgcgg tgtacgcggt gggtctcgtc       360
     gtcgattcgg ccctgtcgat ctggttgctg gaacaggaac tggtggccgc cggactgttc       420
     tccgtcctcg tcttcgcgct ctcgtggatc acggcggagt tcctcggcgc ccggcgggcc       480
     tacgacgagg aggtcgccgc gcgcctcgtc gtcgccgact acgaccggga tcgccgcgcc       540
     gaggatgcgg tggcggccga gcggacccgg atcgcccggg aactgcacga cgtggtcgca       600
     catgcggtga gcgtgatgat cgttcaggcc gacggcgcgt cgtatgccct gaagaccaac       660
     cccgacatcg cgaagcaggc actcaccaac atcgcgagca ccgggcggga ggctctggcg       720
     gaactgcggc gcaccgtctc gctgctgcgc accgaaccgg cgaccgacga catgccccag       780
     cacggcacgg ccggcctcgc ccgagtggtc gacatgatgc gcagcgccgg cctgcccgtg       840
     gaactcgaac tgacggggga gttggacgac atcagccccg cggtcagcct cggcgtccac       900
     cggctggtcc aggaatcgtt gacaaatgtg ctgcggcacg ccggggagcg tccgcgcgcg       960
     aaggtgcggg tgcggcggcg cgagacggat gtcctcgtcg agatcaccga caacggcaac      1020
     tcgtccgggc agttctcgct cgggtcgggc aacggcctgc tcggtatgcg agagcgggtc      1080
     gccgtcctgc acggcaccct cgaggcggga cggcagacag acggcagctg gcgggtcacc      1140
     gcggagttgc cgctcgagct ggaggactga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page