(data stored in ACNUC7421 zone)

EMBL: CP000431.PE161

CP000431.PE161       Location/Qualifiers
FT   CDS_pept        220480..221247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00161"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91997"
FT                   /db_xref="GOA:Q0SKD9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD9"
FT                   /protein_id="ABG91997.1"
FT                   /translation="MNVGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQA
FT                   ALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVFIP
FT                   LIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTGTFL
FT                   IISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLGMAVCNVIGAVIG
FT                   SRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
     atgaatgtgg gtgactgggc gcttcttctc accgccgcga cggccgccgg gtgggtggac        60
     gccgtcgtcg gcggcggcgg actgatcctc attcccgcgc tgtttctcgt cgcaccgcag       120
     ctgacgccgc aggcggcgct ggccaccaac aagctcaccg cattcaccgg cacctccgcc       180
     gccgtcgtca cgttcgcgcg ccggatcccc atgaactggc ggttgctggt tcccgcaggc       240
     ctgctcgcgg cggtggcatc cgcgctcggc gcggcaacgg tgtcgcgcat cgacaaggac       300
     gtcttcatcc cgctcatcat ggcggtgctc gtcggcgttg ccgtcttcgt gacgatccgt       360
     ccgcagctcg ggaccacgct ggcaaaggat ccgccgacac ggcggaaggt cgtcgcggtc       420
     gtcctgctgt ctgccgggct cctcggtttc tacgacggac tgttcgggcc gggcaccggc       480
     acattcctca tcatcagctt cgccacgttc ctcggcacgg aattcgtgcg cagtgcggcg       540
     atggcgaagg tgatcaatct gggatcgaat ctcggtgcgc tggtgttctt cgccgccacc       600
     ggtcacgtgc tgtgggcact cggcctgggt atggcggtct gcaacgtgat cggcgcggtc       660
     atcggctcgc ggatggcact gagcaagggc gccggattcg tccggatcac cctgctgatc       720
     gtggtgatcg cgatggtgat ccggttgggt tggcagcaat tcggctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page