(data stored in ACNUC7421 zone)

EMBL: CP000431.PE162

CP000431.PE162       Location/Qualifiers
FT   CDS_pept        221270..222790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00162"
FT                   /product="probable modulator of DNA gyrase protein, TldD"
FT                   /note="GO_component: GO:0042597 - periplasmic space;
FT                   GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91998"
FT                   /db_xref="GOA:Q0SKD8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD8"
FT                   /protein_id="ABG91998.1"
FT                   /translation="MTAPRQVDPEFLALPLRSLADAALAAARAAGASHADLRVHRLTSQ
FT                   SLRLRDGEVQSAVDTSELGFAVRVVVDGTWGFASHAELTPATAAATAEQAVAVARALRR
FT                   LNREHVELAAEPVHTDVRWVSDYDVDPFEVPASDKISLLGEYSRRLLASDGVDHVTAGC
FT                   LHVKEQTFYADLAGSSIVQQRVRLHPQLEATTVDQSAGVFETMRTLAPPVGRGWEYVAG
FT                   DGVWNWTDELARIPDLLAEKVKAPTVVPGPTDLVIDPTNLWLTIHESIGHATEYDRAIG
FT                   YEAAYAGTSFATPDKLGTLRYGTPIMHVTADRTERHGLATIGYDDEGVETQSWDLVADG
FT                   ILVGYQLDRAFAPRLGLERSNGCSYADSPHHVPIQRMANVSLQPDPDADRSTDDLISDV
FT                   EDGIYVVGDKSWSIDMQRYNFQFTGQRFYRIRGGKLDGQLRDVAYQATTTDFWGSMDAV
FT                   GGRSTWQLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTRTEGGR"
     gtgacggctc cacgacaggt tgatccggaa ttccttgccc tccccctgcg ttcgctggcg        60
     gacgcggcac tcgccgctgc ccgcgcggcg ggcgcgtcgc acgccgacct gcgggtgcat       120
     cggctgacca gccagtcgct gcggctgcgc gacggcgaag tgcagtcggc ggtggacacc       180
     agcgaactcg gcttcgcggt gcgtgtcgtc gtcgacggca cctggggttt cgcgtcgcat       240
     gccgagctga cgccggcgac cgccgccgcg acggcggaac aggccgtcgc ggtcgcccgg       300
     gcgctgcgtc gactgaaccg tgagcacgtc gaactcgccg ccgaaccggt gcacacggac       360
     gtccgctggg tgtccgatta cgacgtcgat ccgttcgaag ttcccgcctc cgacaagatc       420
     tcgctgctcg gtgaatactc ccgcaggctc ctcgcatccg acggtgtcga ccacgtcact       480
     gccggatgcc tgcatgtgaa ggagcagacg ttctacgccg atctcgccgg atcgtccatc       540
     gtgcagcagc gggtgcggct gcatccgcaa ctcgaggcca ccaccgtcga ccagtcggcc       600
     ggtgtgttcg agacgatgcg caccctcgct ccgcccgtcg gccgcggatg ggaatacgtt       660
     gccggcgacg gggtgtggaa ctggaccgac gaactcgccc ggatcccgga cctgctggcc       720
     gagaaggtga aggcccccac cgtggtaccc ggtcccaccg acctggtgat cgacccgacc       780
     aacctgtggc tgaccatcca cgaatccatc gggcacgcca ccgagtacga ccgcgccatc       840
     ggctacgagg ccgcgtacgc cggcacgtcg ttcgccaccc ccgacaagct cggcacgctg       900
     cgctacggga cgccgatcat gcacgtgacc gcggaccgga ccgagcggca cggtctcgcc       960
     acgatcggct acgacgacga aggcgtcgaa acccagtcct gggacctggt tgccgacggg      1020
     attctcgtcg gctaccagct cgaccgggcg ttcgcgcccc ggctcgggct ggagcgttcc      1080
     aacggctgct cgtatgccga ctcgccgcac cacgtcccca ttcagcgaat ggccaacgtg      1140
     tcgttgcagc ccgaccccga cgccgaccgc agcaccgacg acctgatctc cgatgtggag      1200
     gacggcatct atgtggtcgg cgacaagtcc tggtcgatcg acatgcagcg ctacaacttc      1260
     cagttcaccg gtcagcggtt ctaccgcatc cgcggcggga agctcgacgg ccaactccgc      1320
     gacgtcgcgt accaggcgac gaccacggac ttctggggtt cgatggacgc tgtcggcggc      1380
     cgctccacgt ggcagctcgg cggcgccttc aactgcggca aggcgcagcc cggccaggtc      1440
     gcggccgtca gccacggctg cccgtcggca ctcttccgcg gcgtcaacgt actgaacact      1500
     cggacagaag gcggccgatg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page