(data stored in ACNUC7421 zone)

EMBL: CP000431.PE163

CP000431.PE163       Location/Qualifiers
FT   CDS_pept        222787..224148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00163"
FT                   /product="possible modulator of DNA gyrase protein, TldD"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91999"
FT                   /db_xref="GOA:Q0SKD7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD7"
FT                   /protein_id="ABG91999.1"
FT                   /translation="MIAPQQLVEQVLARATVDETIVIVTDASEASLRWAGNSMTTNGVS
FT                   TSRSWTVISIVRAGEDAKVGIVTSASVDAADIDGVVRSAEIAARAATPASDAMPLLTGT
FT                   EADERWDDSAERTEIGAFEQLAQDLSMGFDGSDQLYGFAHHQLHTTWLGTSTGIRRRFA
FT                   QPTGSVEINGKRGDASAWVGTSTKDFTDVASVKLLQDLSTRLDWARNRVELPAGRYETI
FT                   LPPSAVADLMIYLMWTMEGRAAEEGHSALSAPGGTRIGEKLSALPLTLYSDPAALGLEY
FT                   TPFVVTGSSSESVSVFDNGMDAGRVDWIRDGTVNALAYPRAAAKEFGADVTAPGDNLIL
FT                   DAGGSVSLEQMVAETERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVENGKVTGAVNN
FT                   FRFNESPLDLLRRVTQAGATERTLPREWKDWFTRTAMPALRVPDFHMSSVSKAL"
     atgatcgcac cgcagcaact cgtcgagcag gtcctcgccc gggccaccgt ggacgaaacc        60
     atcgtgatcg tcaccgatgc cagcgaggcg tcgctgcgat gggcaggcaa ctcgatgacc       120
     accaacggcg tgtccacatc gcgcagctgg accgtcatct cgatcgtccg ggccggcgag       180
     gacgcgaagg tcggcatcgt cacgtccgcc tccgtcgacg ccgccgacat cgacggtgtg       240
     gtccgctcgg ccgaaatcgc cgcccgcgca gccacacccg catcggacgc gatgccgcta       300
     ctcaccggaa ccgaggccga tgagcggtgg gacgactcgg cggagcgcac cgagatcggc       360
     gcgttcgaac agctcgccca ggatctgagc atgggcttcg acggcagcga ccagctctac       420
     ggcttcgccc accaccagct gcacaccacg tggctgggca cgtcgaccgg gatccggcgc       480
     cgattcgccc agccgaccgg atcggtggag atcaacggca aacgcggcga tgccagcgcc       540
     tgggtgggca ccagcaccaa ggacttcacg gatgtggcca gcgtgaagtt gctccaggac       600
     ctgtccacgc gcctcgactg ggcacgcaac cgggtggagt tgcccgcggg ccgttatgag       660
     acgatcctgc cgccgtccgc ggtcgcggac ctcatgatct acctcatgtg gacgatggag       720
     ggccgggccg ccgaagaagg gcattccgcc ctgtcggcgc ccgggggcac ccgtatcggg       780
     gagaagctga gtgcgctgcc cctcaccctc tattccgatc cggccgcgct cggcctggaa       840
     tacacgccgt tcgtcgtcac cgggtcgtcg tccgaatcgg tgtccgtctt cgacaacggg       900
     atggacgcgg gccgggtcga ctggatccgc gacgggaccg tcaatgcgct cgcgtacccg       960
     cgggctgcgg cgaaggagtt cggcgccgac gtgaccgcgc ccggcgacaa cctgatcctc      1020
     gacgccggcg gttcggtgtc actcgagcag atggtggccg agaccgaacg agggctgctg      1080
     ctgaccaccc tctggtacat ccgggaggtc gaccccgcca ccctgctgct cacgggattg      1140
     acgcgggacg gcgtctacct cgtcgagaac gggaaggtca cgggcgccgt gaacaacttc      1200
     cggttcaacg agagccccct cgacctgttg cggagggtca cccaggccgg tgccaccgag      1260
     cggacgctgc cccgggaatg gaaggactgg ttcacccgaa ccgcgatgcc ggcgttgcgc      1320
     gtcccggact tccacatgtc gtccgtcagc aaggcgctct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page