(data stored in ACNUC7421 zone)

EMBL: CP000431.PE165

CP000431.PE165       Location/Qualifiers
FT   CDS_pept        224570..224917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92001"
FT                   /db_xref="GOA:Q0SKD5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD5"
FT                   /protein_id="ABG92001.1"
FT                   /translation="MTAPRHQRSTTIQEITVSNDVLETAPPAHSIPHRHPDGREVLATA
FT                   KGILIATRGYGDAEAFEELLDVSRHHHVSVMRAAKSLVELATRRQPCPSVTTPAPSYAL
FT                   EFKEWTTLLAR"
     atgaccgcgc ccagacatca gcgaagcacc acaatccagg agatcaccgt gtcgaacgac        60
     gtactcgaaa ccgcaccgcc cgcacattcg attccgcacc gtcaccccga cggacgcgag       120
     gttctcgcca ccgcgaaagg cattctcatc gccacccgcg gttacggcga tgccgaggcg       180
     ttcgaggagt tactcgacgt ctcccgacat catcacgtca gtgtgatgcg ggcagctaag       240
     tcgttggtgg agttggcgac tcggcgacag ccgtgcccgt ccgtgacgac gcccgcaccg       300
     tcgtacgccc tcgagttcaa ggaatggacg acgctgctgg cgcggtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page