(data stored in ACNUC7421 zone)

EMBL: CP000431.PE166

CP000431.PE166       Location/Qualifiers
FT   CDS_pept        complement(224886..225014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92002"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD4"
FT                   /protein_id="ABG92002.1"
FT                   /translation="MSRLWLRRFDRGPLEWLTHRGYQRLTRADRDGVTAPAASSIP"
     gtgtcacgcc tgtggttgcg gcggttcgat cgggggccgc tcgagtggct cacgcaccgg        60
     ggctaccagc gtctcacccg ggcggacagg gacggtgtca ccgcgccagc agcgtcgtcc       120
     attccttga                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page