(data stored in ACNUC7421 zone)

EMBL: CP000431.PE167

CP000431.PE167       Location/Qualifiers
FT   CDS_pept        complement(225020..225544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92003"
FT                   /db_xref="GOA:Q0SKD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92003.1"
FT                   /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVNG
FT                   TGRATGGWAPVQAILQQFAQGKFLGLLTIMFGIGLVIQQRSAQRRGARWPGGYPWRAGL
FT                   LMLDGAPGANPARPVGRSREWAALRSVAMCCRTSCARSSATAGDSASRSGWAAPPSCRR
FT                   RSHCSVRSRQP"
     atgacgtcgc aactgtcgag ttcccaccgc tacgccgcgc tcgacgtcat gcgcggtgcg        60
     gccatcctgg gaaccctcgc caccaacatc tggatcttca ccaacgtcga gggtctggtg       120
     gggtatgtca acggcaccgg acgtgccacc ggcggatggg ccccggtgca ggcgattctg       180
     cagcagttcg cgcagggcaa gttcctcggc ctgctcacca tcatgttcgg catcggactg       240
     gtcatccagc agcgctccgc gcagcgacgt ggcgctcggt ggccgggcgg ctacccgtgg       300
     cgcgcggggc tgctgatgct cgacggagcg ccgggagcga acccggcccg gccggtcggg       360
     cgctctcggg agtgggccgc actgcgctca gttgctatgt gctgcagaac atcctgtgct       420
     cggtcgtctg ctacggctgg ggattcggcc tcgcggtccg gttgggcggc gccaccgtcg       480
     tgccggcgac ggtcgcactg ttcggtgcgg tctcggcaac cctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page