(data stored in ACNUC7421 zone)

EMBL: CP000431.PE168

CP000431.PE168       Location/Qualifiers
FT   CDS_pept        225624..226208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00168"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92004"
FT                   /db_xref="GOA:Q0SKD2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD2"
FT                   /protein_id="ABG92004.1"
FT                   /translation="MPKLIDHDRRQQEIAEAVWRVIQREGIGAVSVRDVAAEAGISSGS
FT                   LRHVFASKTELLAYSMRLVATRVRERAQAHASITDPWQRALAVLDEVLPLDDRRRCEME
FT                   VNLALVAESPAHPLLKDIALDAQRQLRGACAAILTGLAQWGLIAPDIDVDAEAMRLHAL
FT                   VDGAAMHVLLGDTDTPDTARRMIAEHLRTLL"
     gtgccgaagc tcatcgacca cgaccgaagg cagcaggaga tcgccgaggc cgtgtggcgg        60
     gtgatccaac gcgagggcat cggcgccgtg tccgtccggg atgtcgccgc ggaggccgga       120
     atctcgagcg gatcgctccg acacgtgttc gccagcaaga ccgaactcct cgcctattcg       180
     atgcggctcg tcgcaacgcg tgtccgcgaa cgagcacagg cccacgcgtc gatcaccgac       240
     ccgtggcagc gtgccctcgc agtgctggac gaggtactcc ccctcgacga ccgccgacgc       300
     tgcgaaatgg aagtgaacct ggccctcgta gcggaaagcc ccgcccatcc cctactgaaa       360
     gacatcgccc tcgacgccca acggcagctc cgtggtgcat gcgccgcgat cctgaccggc       420
     ctcgctcaat ggggcttgat cgcgccggac atcgacgtcg acgccgaggc gatgcgcctg       480
     cacgcacttg tcgacggcgc ggcgatgcac gttctgctcg gcgataccga caccccggac       540
     accgctcggc gcatgatcgc cgagcatctc cgcacactcc tctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page