(data stored in ACNUC7421 zone)

EMBL: CP000431.PE169

CP000431.PE169       Location/Qualifiers
FT   CDS_pept        complement(226267..226533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD1"
FT                   /protein_id="ABG92005.1"
FT                   /translation="MNHHIALRRRVDRSMRSRRVNIPRRDAHAVVIAGLLASRVLADYF
FT                   GTVTIHEKDHLADNAVHSIRKRGDLIASRTFDDGVVWLRYRPA"
     atgaaccacc acatcgccct gcgtcgccgc gttgaccgat ccatgcgatc gcggcgcgtg        60
     aacatcccac gccgggacgc acacgccgtc gtcatcgccg gactgctcgc gtcccgcgtc       120
     ctcgcggact acttcggtac ggtcacgatt cacgagaagg atcacctggc cgacaacgcc       180
     gttcacagca tcaggaagcg cggcgacctc atcgcgagcc gtacattcga cgacggcgtc       240
     gtctggctcc gctaccggcc cgcgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page