(data stored in ACNUC7421 zone)

EMBL: CP000431.PE170

CP000431.PE170       Location/Qualifiers
FT   CDS_pept        complement(226675..227076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92006"
FT                   /db_xref="GOA:Q0SKD0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD0"
FT                   /protein_id="ABG92006.1"
FT                   /translation="MGPVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLMW
FT                   TVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDAADTDHTRDVIARKYGIL
FT                   GWLTMKGSLLRRGKTGTIGLAVTADDRRG"
     atggggccgg tgaccacaga attcgaccgg gtgtcgtccg cgaagtatgt cctgctcacc        60
     acgtttcgga aagacggcac cccggtggcg acgccgctgt gggccgccgc cgacggtgac       120
     cgtctgttga tgtggacggt caccgactcc tacaaggtca aacgcatccg ccgcaaccca       180
     gaagtgacgg tggccgcatg cgatgctcgc ggcaagccga aggggcccga ggttcctgcc       240
     cgcgccgtca tcctcgacgc tgccgacacc gatcacacgc gggacgtgat cgcccgaaag       300
     tacggcatcc tcggttggct cacgatgaag ggcagcctcc tgcgccgagg aaagaccggc       360
     accatcgggc tcgccgtgac ggccgacgac cggcgtgggt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page