(data stored in ACNUC7421 zone)

EMBL: CP000431.PE174

CP000431.PE174       Location/Qualifiers
FT   CDS_pept        232698..234200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00174"
FT                   /product="probable bifunctional protein, CobI-CobJ fusion
FT                   protein: S-adenosyl-L-methionine-precorrin-2 methyl
FT                   transferase + precorrin-3 methylase"
FT                   /EC_number="2.1.1.130"
FT                   /note="GO_function: GO:0030788 - precorrin-2
FT                   C20-methyltransferase activity; GO_process: GO:0009236 -
FT                   cobalamin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92010"
FT                   /db_xref="GOA:Q0SKC6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC6"
FT                   /protein_id="ABG92010.1"
FT                   /translation="MSSEERVTGKLWGVGIGPGDPELVTVKAARVIAEADVVAFHSARH
FT                   GKSISRAVAAPYLREGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLDAG
FT                   RSVALLAAGDPLFYSSYMHMHKRLVPRFEAEVVPGVTSISAASAALAMPLVEGEEILTV
FT                   LPGTMPPGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTRQKID
FT                   AADDVSDSDVPYFSIAIVPSPSNARRDDAAPQGELVVVGLGPGDQAWTTPEVQHELSLA
FT                   TDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGSRVAVVSSGDPGVFAM
FT                   AAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLKPWDVVAQ
FT                   RISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAGAQESVRVV
FT                   RLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
     atgagctccg aagagcgcgt gaccggcaaa ctgtggggcg tcggcatcgg accgggtgac        60
     ccggaactgg tgacggtgaa ggccgcgcgg gtcatcgccg aggccgatgt ggtggcgttc       120
     cacagcgccc ggcacggcaa gagcatctcc cgcgcggtcg cggcgccgta cctgcgtgaa       180
     ggccagatcg aggagcacct cgtctacccc gtcaccaccg agaccgtcga ccatcccggc       240
     ggctaccagg gggcgatgga cgagttctac gaggaggcgt cgcagcgact cgccgcccac       300
     ctcgacgccg gccgttcggt cgcgctcctc gcggcgggcg acccgctgtt ctacagctcc       360
     tacatgcaca tgcacaagag gttggtgcct cgcttcgagg cggaggtcgt tcccggggtc       420
     acgtcgatca gcgccgcctc cgccgcactg gcgatgccgc tggtcgaggg cgaggaaatt       480
     ctgaccgtcc tgcccggaac gatgccgccc ggcgagctga cgcggcgcct gcgggagacc       540
     gacgccgccg ccatcctgaa gctcggacgc acctacccgg ccgtccggca ggcgttgaag       600
     gactccggcc gcatcgacga gacgtggtac gtcgagcggg ccagcacgac ccggcagaag       660
     atcgacgccg ccgacgacgt ctcggacagc gacgtcccct acttctcgat cgccatcgtg       720
     cccagcccgt cgaacgcccg ccgcgacgac gcggcaccgc agggcgaact cgtcgtcgtc       780
     gggctcggtc ccggcgacca ggcctggacg acaccggaag tgcagcacga actgtcgctc       840
     gccaccgatc tcgtcggcta cggcccctac atcgaccggg tccccgaacg tcccggccag       900
     cgccgtcact ccagcgacaa ccgcgtcgag gccgaacgcg ccgcgatggc actcgacctg       960
     gcgaagaacg ggtcccgcgt cgccgtcgtg tcgtccggtg acccgggtgt gttcgcgatg      1020
     gccgccgcgg tgctggaagt agcggccgag gagcagtggc gcggcgtccc cgtgcgtgtc      1080
     ctgcccggca tgaccgccgc gaacgctgtc gcgagccggg tcggcgcacc cctcggccac      1140
     gactacgccg tcctgtcgct gtcggaccgg ctcaagccgt gggacgtggt ggcgcagcgc      1200
     atctcggcgg tcgcaagcgc cgacatggcc ttcgccgtat acaacccggc gtcgaagtca      1260
     cgcacctggc aggtcgccgc gatgcgcgac ctggtcctcg agcaccgctc ccccgacacc      1320
     ccggtgatca tcggccgcga cgtggccggc gcgcaggagt cggtgcgggt cgtgcggctc      1380
     gcggacctcg acccggccga gatcgacatg cggtgcctgc tcatcgtggg ctcctccatg      1440
     acgaccgtgg tcgagaacga acacgggacc agggtgttca cgccccggcg ttatccgggc      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page