(data stored in ACNUC7421 zone)

EMBL: CP000431.PE176

CP000431.PE176       Location/Qualifiers
FT   CDS_pept        complement(235114..236058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00176"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92012"
FT                   /db_xref="GOA:Q0SKC4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92012.1"
FT                   /translation="MPGKRWRREMGAAGTDSMVAMDLLRHLSFFVAVAEEGHFGNAASR
FT                   LGMTQPPLSQGVRRLEQRLGAELVHRSARGIGLTDAGRQLLPRARLLVADAARFEDEAH
FT                   RIAGGRDAVVRWGVPHSVADGVVVRCVRALRDADETRPTRVVTTTASTTELVDAVRTGS
FT                   LDVAVVEHPALLTGLDSGPVLKLRRWVVVPDDHPAAVAKKAQVRMLRGLALATGPRSDN
FT                   PPAHDLFVDLWRARGLDPDIVVAPGPREIFTHVAAGGHFGVTATAPTVMPGVAWVDLLR
FT                   EDLALRVRIVWRSGTDVAPSAAALDRVLLRAGR"
     gtgcccggga aacgatggcg tcgcgagatg ggggcggccg gaactgattc aatggtcgcc        60
     atggatctgc tccgccacct cagtttcttt gtcgccgttg cggaggaggg acatttcggc       120
     aacgccgcat ccaggctcgg gatgacgcag ccgccgctgt cacagggagt gcggcggctc       180
     gaacagcgac tcggcgcgga gctggtccat cgcagtgccc gcggaatcgg actcaccgac       240
     gccggacgcc aattgcttcc gcgtgcgcga cttctcgtcg ccgacgccgc ccgattcgag       300
     gacgaggcgc accgcatcgc cggcggtcgc gacgcggtgg tgcgatgggg tgtcccgcac       360
     tcggtagccg acggtgtggt ggtgcggtgt gtccgtgccc tccgcgacgc ggacgagacc       420
     cggcccaccc gggtggtgac gaccacggcg tccaccaccg aactcgtgga cgccgtccgc       480
     acgggcagtc tcgacgtcgc cgtggtcgag catcccgctc tgctcaccgg tctcgacagc       540
     gggccggtgc tgaagcttcg gcggtgggtg gtggtgccgg acgaccaccc ggcggcggtc       600
     gcgaagaagg cacaggtccg gatgctgcgc gggctggcgt tggccaccgg tccacgctcg       660
     gacaatccgc ctgcccacga cctgttcgtc gacctgtggc gggcccgagg gctggacccg       720
     gacatcgtgg tcgcaccggg tccgcgcgaa attttcacgc acgtggccgc aggcggtcat       780
     ttcggcgtga cggcgacggc accgacggtg atgccgggtg tggcctgggt cgatctgctg       840
     cgcgaagacc tcgcgctgcg cgtgcgcatc gtctggcgct cggggaccga cgtggcaccg       900
     tccgctgccg ccctcgaccg ggtgctgctg agggccggtc gatga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page