(data stored in ACNUC7421 zone)

EMBL: CP000431.PE177

CP000431.PE177       Location/Qualifiers
FT   CDS_pept        236155..237108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00177"
FT                   /product="beta-lactamase, penicillin binding protein"
FT                   /EC_number="3.5.2.6"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0008800 - beta-lactamase activity; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0009252
FT                   - peptidoglycan biosynthesis; GO_process: GO:0030655 -
FT                   beta-lactam antibiotic catabolism; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92013"
FT                   /db_xref="GOA:Q0SKC3"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC3"
FT                   /protein_id="ABG92013.1"
FT                   /translation="MSTHRNHPKPRRTGRRGAVALALALPLLLGACTATAEQAQPTTSV
FT                   AAIPDRRSLDATIDALEAQYSTRIGVTAVNPATGEVYSHRGDERFAMCSTFKAYASAAV
FT                   LRKTEDGSTSLDKTVVIEPGDLVENSPVTAAAVGAPMTLGQIAEAALTQSDNTAGNYLL
FT                   REIGGPQAITALARDVGDGGTRLDRWETELNTAFRDDPRDTTTPNGLAQGFRALLLGDA
FT                   LDTASRDQLLEWMRASKTSDKRMRAGLPTGWTAADKTGGGGFGTANDAGVAWSPDGAPL
FT                   VLAILTDSLTNQQDAQGNNQAIADTTAAVIEGLTAP"
     atgtccaccc accgaaatca tccgaagccc aggcgcaccg gtcgccgagg tgccgtcgcc        60
     ctcgcgctgg ctctgccctt gctgctcggg gcgtgcacgg ccaccgcgga gcaagcccag       120
     cccaccacat cggtggccgc gataccggat cgccggtccc tcgacgcgac gatcgacgcc       180
     ctggaggcgc agtactccac gcggatcgga gtgacggccg tcaatcccgc gaccggcgag       240
     gtctacagcc accggggtga cgaacggttc gcgatgtgct ccacgttcaa ggcctacgca       300
     tccgcggcgg ttctgcgcaa gaccgaggac gggtcgacgt cactcgacaa gacggtcgtg       360
     atcgaacccg gcgacctcgt cgagaactcg ccggtcaccg ccgcagcggt cggcgccccg       420
     atgacgttgg ggcagatcgc cgaagccgcg ttgacgcaga gcgacaacac cgccgggaac       480
     tacctgctcc gggagatcgg cgggccgcag gcgatcaccg ccctcgcccg ggacgtcggc       540
     gacgggggca cacggctgga ccggtgggag accgaactca acaccgcatt ccgcgacgac       600
     ccccgggaca cgacgacacc gaacggcctc gcgcagggtt tccgggcgct gctcctcgga       660
     gatgccctcg acacggcgag ccgcgatcag cttctcgagt ggatgcgggc gagcaagacg       720
     tcggacaagc gaatgcgcgc cggtctgccg accgggtgga ctgccgccga caagaccggt       780
     ggcggcgggt tcggcaccgc caacgatgcc ggtgtcgcgt ggagtccgga cggcgcaccc       840
     ctcgtcctcg ccatcctcac cgacagcctc accaatcagc aggacgcgca gggaaacaac       900
     caggcgatcg ccgacaccac cgcggccgtc atcgaaggct tgactgcgcc gtga             954
//

If you have problems or comments...

PBIL Back to PBIL home page