(data stored in ACNUC7421 zone)

EMBL: CP000431.PE180

CP000431.PE180       Location/Qualifiers
FT   CDS_pept        238588..239337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00180"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0016564 - transcriptional repressor
FT                   activity; GO_process: GO:0006808 - regulation of nitrogen
FT                   utilization; GO_process: GO:0009225 - nucleotide-sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92016"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC0"
FT                   /protein_id="ABG92016.1"
FT                   /translation="MKIVIFGTGLIGSQVASKLTETGHDVAALGRGDGIDTTTGKGVAE
FT                   AVEDADVVVDLTNSPSWEDDDVLAFFRESTNHLLAAEEAAGVRHHVVLSIVGADRLPDS
FT                   GYMRAKVAQEDLVKSGPIPYSIVRSTQFFEFIAGIADAGTVGDTVHATPAHLQPIASHD
FT                   VVTRVAEVAVGAPLDGTIEIAGPEPLGIDALVRRLFAATGDQRTVTTDPDTGYFGAKLD
FT                   DAAITPTPGANAWIAPTTLDEWLREHA"
     atgaagatcg tcattttcgg aaccggactg atcgggagtc aggtcgcatc aaagctgacc        60
     gagaccggtc acgacgtcgc tgcactcggt cgcggcgacg gcatcgacac caccaccggc       120
     aagggcgtcg cggaggctgt ggaggacgcc gacgtcgtcg tggacctgac caactcgccg       180
     tcatgggaag acgacgacgt cctggctttt ttccgcgaat cgacgaacca cctgctcgcc       240
     gccgaagagg cggcaggcgt ccggcaccat gtcgtcctgt ccatcgtcgg cgccgaccgg       300
     ctccccgact ccggatacat gcgcgccaaa gtcgcccagg aggatctggt caagtccggc       360
     cccatcccct actcgatcgt gcggtcgacg cagttcttcg agttcatcgc cggtatcgcc       420
     gacgcaggca ctgtcggcga cacggttcat gcgaccccgg cacaccttca gccgatcgcc       480
     tcgcacgacg tcgtcacccg ggtagccgaa gtcgccgtgg gcgccccgct cgacggcacg       540
     atcgagattg ccgggccgga accgctcggc atcgatgcac tcgttcgacg gctgttcgcg       600
     gcgaccggcg accagcggac cgtgaccacc gaccccgaca ccggctattt cggcgccaag       660
     ctcgatgacg ctgcgatcac accgacaccc ggcgccaatg cctggatcgc accgaccacg       720
     ctggacgagt ggttgcgcga acacgcctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page