(data stored in ACNUC7421 zone)

EMBL: CP000431.PE182

CP000431.PE182       Location/Qualifiers
FT   CDS_pept        complement(240176..240478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92018"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB8"
FT                   /protein_id="ABG92018.1"
FT                   /translation="MINARRTIAAVAFAALPVLSAFGAASVAHAEPIGPNGPTGGPCPI
FT                   VNTDSQGNETVTYGKPGDRNGALVCGADGEWTVGKAGGFKGGPGQIQTQPGLSRG"
     atgatcaacg cccgccgcac cattgccgct gtcgctttcg ctgctcttcc cgtcctgagt        60
     gccttcgggg cggcgtccgt tgcgcatgcc gagccgatcg gcccgaacgg gcccaccggt       120
     ggcccgtgcc cgatcgtgaa cacggactcg cagggcaacg agacagtgac gtacggcaag       180
     cccggagacc gcaacggcgc cctggtatgc ggtgcggacg gggaatggac ggtgggcaag       240
     gccggcggtt tcaagggcgg tcccggacag attcagactc agcccggact ctcacgcggg       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page