(data stored in ACNUC7421 zone)

EMBL: CP000431.PE184

CP000431.PE184       Location/Qualifiers
FT   CDS_pept        241083..242567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00184"
FT                   /product="possible multidrug efflux transport protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0015520 - tetracycline:hydrogen antiporter
FT                   activity; GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92020"
FT                   /db_xref="GOA:Q0SKB6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92020.1"
FT                   /translation="MTSHPPLDLESTRDFSVVCMTSTAPSPASWSELLGPRCRSTSAVL
FT                   AGGVGLHAVNIFLTTSLLPTAIGELGRESLYAWSATVFMVASVISSMTVSRLLAHRGAL
FT                   GAYLFALVPFFVGTMICAVSPSMEVLLVGRAVQGVGGGLLAGLGYAVLREALPEHLWAR
FT                   ATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVTAAIAVIAPRALPRTERVRG
FT                   GEPVPATSLVLLTLATIAISVASIVGNRTHMLALIAVGAAFIVLFLAWERRSPRRVLPQ
FT                   STYTRASSLKWIYLTIAVLASGTVSEAFTPLFGQRLAGLVPFAAGFLGAMMSVGWSATM
FT                   IFSSDISRQRAQTAAKIAGPAVLAAGLLLTAALWRDAAGPVTVILWAGTLAIAGAGIGL
FT                   AFPHLMVAAMRSTDDEQEGAKAAAGLNTVELIAMAVGSAVAGVLVNLGAPSTLASARLL
FT                   FLGLGVIAAVGVFTAYRATRQAEREDAGRPYVRDAK"
     atgacatcac atccgcccct tgacctcgag tccactcgag attttagcgt ggtgtgcatg        60
     acatcgaccg ccccgtcacc ggccagctgg tccgaactgc tcggaccccg ttgccgctcc       120
     acctccgccg tcctcgccgg cggtgtggga ctgcacgccg tcaacatctt tctgacgacg       180
     agcctgctgc ccaccgccat cggcgaactc gggcgcgaat cgctgtacgc gtggagcgcg       240
     accgtcttca tggtggcgtc cgtgatctcg tcgatgaccg tcagccggct gctcgcacat       300
     cgcggggcgc tcggtgcgta cctgttcgcc ctggttccgt tcttcgtcgg cacgatgatc       360
     tgcgccgtca gcccgtcgat ggaggtgctc ctcgtcggac gagctgtcca gggggtcggt       420
     gggggcctgc tcgcggggct cggttacgcg gtactgcgcg aggcgctacc ggagcatctg       480
     tgggcccgcg cgaccgcgct ggtctcggcg atgtggggcg tcggaaccct ggccggaccg       540
     gcgatcggtg ggctgttcgc gcaactcggc cagtggcgtc tcgcgttcgt cgccctggca       600
     gtggtcaccg ccgccatcgc cgtgatcgcg ccccgggcgt tgccgcgcac cgagcgtgtg       660
     cgtggcggag aacccgtgcc tgccacgtca ctcgtcctgc tcaccctcgc gacgatcgca       720
     atcagcgtgg cgagcatcgt cggcaaccgg acccacatgc tggcgctgat cgcggtcggt       780
     gccgcgttca tcgttctctt cctggcctgg gagcggcgat caccgcgccg ggtgttgccg       840
     cagtcgacgt acacccgggc gtcgtccctg aagtggatct acctcaccat cgcggtgctc       900
     gcgtccggca ccgtgtcgga ggccttcaca ccgctgttcg gtcaacgact cgccggactg       960
     gtgccgtttg ccgcaggatt cctcggcgcc atgatgtcgg tgggatggtc ggcgaccatg      1020
     atcttcagct ccgacatctc ccgccagcgt gcgcagacgg cggcgaagat cgccggacct      1080
     gcggtcctcg ccgccggcct gctcctcacg gcggcactct ggcgtgacgc cgccggaccg      1140
     gtcacggtga ttctgtgggc gggcaccctg gccatcgcag gtgccggaat cggcctcgcc      1200
     ttcccacacc tgatggtcgc cgccatgcgg agcaccgacg acgagcagga gggagcgaag      1260
     gccgcggccg ggctcaacac ggtcgagttg atcgctatgg ccgtgggatc agccgtcgcc      1320
     ggtgtactgg tcaatctcgg tgcgccctcg accctcgcct ccgcacgact actcttcctc      1380
     ggcctcggcg tcatcgcggc ggtcggcgtg ttcaccgcgt accgcgcgac ccggcaagcc      1440
     gagcgcgagg acgccggacg gccctacgtc cgcgacgcga agtga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page