(data stored in ACNUC7421 zone)

EMBL: CP000431.PE186

CP000431.PE186       Location/Qualifiers
FT   CDS_pept        complement(243513..243800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92022"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92022.1"
FT                   /translation="MQKKSARRTAALVGILSAPLVLGATVGAGTASAEPWHIGPVYRAE
FT                   TSGEGAEYFCGKAAALEQTSGAVIVPCTFDEPTNVWYRVVFNPASWGFDF"
     gtgcagaaga agtcggctcg gcgtaccgca gcattggtcg ggatactgtc cgcgcccctc        60
     gtcctcggag ccaccgtcgg ggccggaacc gcgagtgccg aaccatggca catcggcccc       120
     gtctaccgtg ccgagacgtc cggtgaaggc gcggagtact tctgcgggaa ggccgcggcg       180
     ctcgaacaga cgtcgggagc cgtgatcgtg ccgtgcacgt tcgatgaacc gaccaacgtc       240
     tggtaccgcg tcgtcttcaa tccggcctcc tggggcttcg acttctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page