(data stored in ACNUC7421 zone)

EMBL: CP000431.PE187

CP000431.PE187       Location/Qualifiers
FT   CDS_pept        complement(243868..244497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00187"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004222 - metalloendopeptidase activity; GO_process:
FT                   GO:0006508 - proteolysis; GO_process: GO:0016998 - cell
FT                   wall catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92023"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB3"
FT                   /protein_id="ABG92023.1"
FT                   /translation="MTTRNMEKYTLGWIALIGAVVTVLLGLGAGTAGGAPHDWEEVAEC
FT                   ESGGDWTTDTGNGFYGGLQFTPETWKANGGTGVASEASQAEQIRVAENVLKTQGPGAWP
FT                   VCGQYLKKGGTAPVEVPHTTPAPAPAIETPDPVETPDLVETPDVVETPDVVETPDVVEA
FT                   PATVDDSAAVKAAVKAAAQEALNSARELAEQNGSGQVFEERASAPR"
     atgaccactc gcaacatgga aaagtacacc ctcggctgga tcgccctgat cggcgcggtc        60
     gtcaccgttc tgctcgggct gggcgccgga accgccggag gcgccccgca cgactgggag       120
     gaagtcgccg agtgcgaaag cggcggcgac tggaccaccg acaccggaaa cgggttctac       180
     ggcggactgc agttcacacc ggaaacctgg aaggccaacg gtggaacggg cgtggcctcg       240
     gaagccagtc aggccgagca gatccgggtc gccgagaacg tcctgaagac ccagggcccc       300
     ggcgcgtggc ccgtgtgcgg acagtatctg aaaaagggtg gcacagcgcc cgtcgaggta       360
     ccccacacca cgcctgcacc tgcaccggcc atcgaaactc ccgaccctgt cgagactcct       420
     gacctcgtcg agacgccgga cgttgtcgag acgccggacg ttgtcgagac gccggatgtt       480
     gtcgaagcgc ctgcgaccgt cgacgattcc gccgcggtga aggcagcggt gaaggcggcg       540
     gcccaggaag cgctgaacag cgcgcgtgaa cttgccgagc agaacgggtc gggtcaggtg       600
     ttcgaggagc gggcgtcggc tccccggtaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page