(data stored in ACNUC7421 zone)

EMBL: CP000431.PE188

CP000431.PE188       Location/Qualifiers
FT   CDS_pept        complement(244980..245843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00188"
FT                   /product="probable transcriptional regulator, LuxR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92024"
FT                   /db_xref="GOA:Q0SKB2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB2"
FT                   /protein_id="ABG92024.1"
FT                   /translation="MRVPVNDTLRPSDTDAIRAELRDLRRQTDFPVLFGGTVEGGHLTL
FT                   SGFVGTRSTILRDLVIDAECGVGGRAIAEQRPIGIQDYSNSESITHEYDVQVGAEGIET
FT                   LLAVPVVVRGRTRGTLYGGLRANRPLGDRVTDRVMRGAARLARELDIRDEVDRRLAMLA
FT                   ASSGVDRGVPRDVRVSEAITESYLALRDIADRLGDDGLGAEVQAVEQKLRRLTAPGDPS
FT                   TVTLSRRESDVLAHVALGCRNAEIADRLSLSVETVKSYMRNLMGKLEVRSRQEAVVEAR
FT                   RQGLLP"
     atgagagtgc cagtgaacga cacgttgaga cccagcgaca ccgacgcgat ccgcgccgaa        60
     ctacgcgacc tacggcggca gaccgacttt ccggtgctct tcggaggcac ggtcgagggc       120
     gggcatctca cgctgtccgg cttcgtggga acacggagca cgatcctgcg cgacctcgtc       180
     atcgacgcgg agtgcggcgt cggcggtcgc gccatcgcgg agcagcgccc gatcgggatc       240
     caggactact cgaactcgga gtcgatcacg cacgagtacg acgtccaggt gggcgccgag       300
     gggatcgaaa ccctgctcgc ggtccccgtc gtggttcgtg gccgcacgcg cggcaccctt       360
     tacgggggac tgcgcgccaa ccgcccgctc ggtgaccggg tgaccgaccg ggtgatgcgc       420
     ggggcggcca ggctggcgcg cgagctcgac atccgggacg aagtcgaccg caggctcgcc       480
     atgctcgccg cgtcgagcgg cgtagatcgc ggcgttccgc gagacgtgcg cgtgtcggaa       540
     gcgatcaccg agagctacct cgcgcttcgc gacatcgcgg acaggctcgg cgacgacggt       600
     ctcggcgccg aggtgcaggc ggtcgagcag aagttgcgcc gacttaccgc gccgggcgac       660
     ccatcgacgg tgacgctgtc gcggcgtgag agtgacgtcc tggcgcacgt ggcgctgggg       720
     tgccgcaatg ccgagatcgc cgaccggctg tcgctgagcg tcgagaccgt caagtcgtac       780
     atgcgcaatc tcatgggcaa gttggaggta cgcagcaggc aggaagctgt tgtggaagcc       840
     cgacgtcagg gtttgcttcc ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page