(data stored in ACNUC7421 zone)

EMBL: CP000431.PE189

CP000431.PE189       Location/Qualifiers
FT   CDS_pept        245955..247559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00189"
FT                   /product="acyl CoA synthetase, AMP-binding protein"
FT                   /note="GO_function: GO:0016208 - AMP binding; GO_function:
FT                   GO:0016874 - ligase activity; GO_process: GO:0006869 -
FT                   lipid transport; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92025"
FT                   /db_xref="GOA:Q0SKB1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92025.1"
FT                   /translation="MSGPTLSTANHTPLSPLRFLERSASVFPDRIAVVHGDRRYSYREF
FT                   GDEVERLARVLRSRIEPGDRVAFLCPNTPEMLFAHFAVPLAGGVLIALNSRLAGRELEY
FT                   ILEHSGTSLLFVDSELVGSVATAREAVPSLREVIEIPDSTIARPMVPEGIVTGMYADFL
FT                   AAADDVDGTPLHWGVDDEQQVIAINYTSGTTGKPKGVMYTHRGAYLNSLGETFHNGFAG
FT                   STKYLWTLPMFHCNGWCTPWAVTQAAGTHICLRAVRADAIWDAIDTLGVTHLCGAPAVC
FT                   STIAEAPQAHPVDALRITTAGAPPSPTVIAQLEAIGVTVVHVYGLTEVYGPYTICEYQD
FT                   SWSDRTAEERASLLSRQGVGMVQAENARVVDAQMNDVPADGETMGEIVLRGNNVMLGYY
FT                   RDPEATAEAFAGGWFHTGDLGVMHADGYIQLKDRAKDIVISGGENISTVEVEQAMMTHP
FT                   AVLDVAVVGVPHPKWGERPKAFVIVKKGATVTAEELVEHTRGRIAKFKVPDEIVFPLEL
FT                   PRTPTGKVLKFELRNSN"
     gtgtccggac cgaccctctc gaccgcgaac cacacaccgc tcagcccgct gcgcttcctc        60
     gagcgctcgg cgagcgtgtt cccggaccgg attgccgtcg ttcacggcga ccgccgctac       120
     agctaccgcg agttcggcga cgaggtcgag cgactcgccc gggtcctgcg gagccggatc       180
     gagcccggcg accgcgttgc attcctgtgc ccgaacaccc ccgagatgct gttcgcgcac       240
     ttcgcggtgc ccctcgcagg cggcgtcctc atcgcgctga actcgcggct ggcgggccgc       300
     gaactggagt acatcctcga gcactccgga acgagcctgc tgttcgtcga ctccgaactg       360
     gtcggatccg tcgcgaccgc ccgcgaggcg gtcccgagtc tgcgcgaggt gatcgagatc       420
     cccgactcga cgatcgcgcg gccgatggtc ccggagggga tcgtgaccgg gatgtacgcc       480
     gacttcctcg ccgccgcgga cgacgtggac ggcaccccgc tgcactgggg tgtcgacgac       540
     gaacagcagg tgatcgcgat caactacacg tccggaacca ccgggaaacc gaagggcgtg       600
     atgtacacgc accgcggtgc ctacctcaac tccctcggcg agacgttcca caacggcttc       660
     gccgggtcca ccaagtacct gtggacgctg ccgatgttcc actgcaacgg ctggtgcacc       720
     ccgtgggcgg tcacgcaggc cgccggcact cacatctgcc tgcgggcggt gcgagccgat       780
     gcgatctggg acgccatcga caccctcggt gtcactcacc tgtgcggcgc tcccgcggtg       840
     tgctccacca ttgccgaagc gccccaggca catccggtcg acgccctgcg aatcaccacc       900
     gccggggcac cgccgtcacc gacggtgatt gcccagctgg aggcgatcgg cgtcaccgtc       960
     gtccacgtgt acgggctgac cgaggtctac gggccgtaca cgatctgcga gtaccaggac      1020
     tcgtggagcg atcggaccgc cgaggagcgt gcgtccctgc tgtcccggca gggcgtgggc      1080
     atggtgcagg cggagaacgc ccgcgtggtc gacgcgcaga tgaacgacgt gccggcagac      1140
     ggcgagacca tgggggagat cgtgctgcgc ggcaacaacg tgatgctcgg ctactaccgc      1200
     gatcctgagg cgactgcgga agcgttcgcg ggtggctggt tccacacggg cgatctcggc      1260
     gtcatgcacg cggacggtta catccagctc aaggaccgcg cgaaggacat cgtcatctcc      1320
     ggcggcgaga acatctcgac cgtcgaggtg gagcaggcga tgatgacgca tcccgccgta      1380
     ctcgacgtcg cggtcgtcgg tgtcccacat cccaagtggg gtgagcggcc caaggcattc      1440
     gtcatcgtga agaagggggc caccgtcacg gccgaggaac tcgtcgagca cacccgtggg      1500
     cgcattgcga agttcaaggt tcccgacgag atcgtctttc ccctcgaact cccccgcact      1560
     cccaccggga aggtcctcaa gttcgaactt cgaaattcga actga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page