(data stored in ACNUC7421 zone)

EMBL: CP000431.PE190

CP000431.PE190       Location/Qualifiers
FT   CDS_pept        247642..248373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB0"
FT                   /protein_id="ABG92026.1"
FT                   /translation="MGEPGVDAFAIFHAANQWVTPMVALDYDVEPGMQHRLLRKLAGRG
FT                   WRDPSPVIDGVDGVTSPVLSLRSLDGRTLLIEDDTDVLFEGVVVPPHGWIDDVRALGAV
FT                   GVIAGAGITSMPDWERQLPRLARESELLGSVATVTLTNAFGREDVNAFAYEVISALRPM
FT                   LPADALHDAGFALEDDRPHRAVIEVVASAARHQVVVPARIFDLVHRRATDRTSFGWRES
FT                   RILRRLLRKVRTDERASNAEV"
     atgggggaac caggagtcga cgcgttcgcc atcttccacg cagcgaacca gtgggtcaca        60
     ccgatggtgg cgctcgacta cgacgtcgaa cccggcatgc agcaccgcct gctgcggaag       120
     ttggcggggc gcggatggcg ggatcccagc cccgtcatcg acggcgtcga cggcgtgacg       180
     tcgccagtgc tgtcgttgcg atcgctcgac gggcgcaccc tgttgatcga ggatgacacg       240
     gacgttctct tcgagggcgt cgtcgtgccc ccacacgggt ggatcgacga tgttcgagcc       300
     ctcggcgcgg tcggcgtgat cgccggagcg ggcatcacct cgatgcccga ctgggaacgg       360
     caactccccc ggttggcccg cgagagcgaa ctgctcggtt ccgtcgccac ggttaccctc       420
     acgaacgcct tcggcaggga agatgtcaac gcgtttgcat acgaggtgat ctcggcgttg       480
     cggccgatgc tccctgccga cgcgctgcac gacgccggct tcgcgctcga ggacgaccgg       540
     ccccaccgcg cggtcatcga ggtcgtcgca agtgcggcga gacaccaggt ggtcgtcccc       600
     gcacgaatat tcgacctggt ccaccgccgc gccacggacc gcacctcgtt cgggtggcgg       660
     gagtcccgaa tactgaggcg gctcctgcga aaggttcgca ccgacgaacg cgcatcgaac       720
     gccgaagtct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page