(data stored in ACNUC7421 zone)

EMBL: CP000431.PE191

CP000431.PE191       Location/Qualifiers
FT   CDS_pept        248615..250018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00191"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92027"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92027.1"
FT                   /translation="MSRSVAGGASEDAERRAYARVRAGHVNAVHAALEDHLGRLDWPRD
FT                   QIERYRTDRLRALLAHARERSPFHARRLRDLDPSSASLTDLATLPMMTKRDAQDEWDAI
FT                   VTVRDLDRERAERILAEQQWFSYTSGDEQIFSSGGSSGVRGVYVWDWQFYVSAACLAWR
FT                   VQAREERRASSVRSPARLAVLAAGVPPHASTPLFDVPTAPGMETVVIPAGAPFDEIVAA
FT                   VAAARPTHLVGYATVIGRLARATVAGDLKISPARVSTNSEPLLEEDRQAIRDAWSVPIH
FT                   NLWGSTEIGVQAVGCGYGEGLHVCEDEVVLERVDDSGAPVAADAPAARTLATGLANRTF
FT                   PFIRYDLGDQVTLLPGGCACGSAFARVADIGGRRDDDFRYGTTIVPASTFRYVLGADPR
FT                   ISEYQVRQTADGAEIFAVGDPDVAALTPAVTAALRRQGVADPQVRIEVVDHLQRHLASG
FT                   KLQRFIALR"
     atgtcccgat cggttgccgg aggtgcttcg gaagacgcgg agcgcagggc gtacgcgcgt        60
     gtgcgcgccg gccatgtgaa tgcggttcac gccgccctcg aggatcacct gggacgcctg       120
     gactggccga gagatcagat cgagcgctac cgaaccgacc ggctgcgggc cctcctcgcg       180
     cacgcacgcg agcggtcgcc atttcacgcc cggaggcttc gtgatctcga tccgtcctcg       240
     gcctcgctca ccgacctggc aacgctgccg atgatgacga agcgggacgc tcaggacgag       300
     tgggatgcga tcgtcacggt gcgcgacctc gatcgcgaac gtgccgaacg gattctggcc       360
     gagcagcaat ggttttcgta cacgtcgggc gacgagcaga tcttcagctc gggtgggtcc       420
     agtggtgtcc ggggcgtcta cgtctgggat tggcagttct acgtttcggc ggcgtgcctt       480
     gcctggcggg tacaggcgcg cgaggaacgg cgggcgtcgt cggtgcggtc tcccgcgcgg       540
     ctggccgtgc tggcggccgg tgtccccccg catgcgagca cgccactgtt cgacgtgccg       600
     accgcaccgg gaatggagac cgtcgtgatc ccggcgggcg caccgttcga cgagatcgtc       660
     gccgcggtgg ccgcggcccg gcccacgcat ctggtgggct acgcgacggt catcgggcga       720
     cttgcccggg ccacggtggc gggtgatctg aagatcagtc ctgcgcgggt aagcacaaac       780
     tccgaacccc tgctggagga ggatcggcag gccatccgcg acgcctggtc ggtgccgatc       840
     cacaacctct gggggtcgac cgagatcggc gtgcaggccg tgggttgcgg atacggcgag       900
     ggcctgcacg tgtgtgagga cgaggttgtg ctcgagcgtg tcgatgacag tggtgctccg       960
     gtcgcagccg atgcgcccgc ggcgcgaacg ctcgcgacgg gtctggccaa ccgcacgttt      1020
     cccttcatcc gatacgacct cggagaccag gtcacgttgc tgcccggtgg gtgcgcgtgc      1080
     ggaagcgcgt tcgcacgcgt cgccgacatc ggtgggcggc gcgacgacga tttccggtac      1140
     ggaacgacga tcgtgcccgc aagcactttt cgctacgtcc tcggtgcaga tccgcgtatt      1200
     tccgagtacc aggtccgaca gaccgccgac ggagcggaga tcttcgcggt cggcgacccc      1260
     gacgtcgccg ccctgacgcc ggctgtcacg gcggcattgc gccggcaagg tgtggccgat      1320
     ccgcaggtcc ggatcgaagt ggtcgaccat ctgcagcgtc atctcgcgag cgggaaactg      1380
     cagcggttca tcgcactgcg atag                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page