(data stored in ACNUC7421 zone)

EMBL: CP000431.PE193

CP000431.PE193       Location/Qualifiers
FT   CDS_pept        250511..251125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00193"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0005554 - molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92029"
FT                   /db_xref="GOA:Q0SKA7"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA7"
FT                   /protein_id="ABG92029.1"
FT                   /translation="MTLGTVRLSSAIRDGTHFSWCRTCSRATVRRVAPVEMGAGTANLD
FT                   ERVPRNRGTGSVRHEELRAHFRYPEDLFTVQREMIAKYHVDDPREFFTTNAFWSVPSDP
FT                   IVDDNPHQPPFDVLVGDRGTAQPSFRPAGAIVGHNREFLSSYISAHSDPENYGKISVLQ
FT                   LPTDTLTQGPQQVQNSVISHSMSEESPPRTVRRRMRPRLSS"
     atgacgctgg gcactgttcg cctgtccagc gcaatccggg acggcaccca tttctcgtgg        60
     tgccggacgt gtagccgcgc cacggtgcga cgcgttgcgc ccgtcgagat gggcgccggt       120
     actgcaaacc tggatgaacg tgttccccgg aaccgtggaa ccggaagcgt ccgtcacgag       180
     gaactccgcg cacacttccg ctatcccgag gacctgttca ccgtccaacg cgagatgatc       240
     gcgaaatatc acgtcgacga tccccgcgaa ttcttcacca ccaacgcctt ctggtcggtt       300
     cccagcgacc cgatcgtcga cgacaatccc caccagcccc cgttcgacgt cctcgtcggg       360
     gaccggggca ccgcgcagcc gtcgttccgg ccggccggcg ccatcgtcgg acacaaccga       420
     gaattcctct cgtcgtacat ctccgcgcac tccgacccgg agaactacgg aaagatcagc       480
     gtgctgcagt tgcccaccga cacgctcacc cagggcccgc aacaggttca gaactcggtg       540
     atctcccact cgatgtcgga ggaatcacca ccccggaccg tccgacggcg gatgcgaccg       600
     cgcctgtcga gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page