(data stored in ACNUC7421 zone)

EMBL: CP000431.PE194

CP000431.PE194       Location/Qualifiers
FT   CDS_pept        complement(251271..251750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92030"
FT                   /db_xref="GOA:Q0SKA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92030.1"
FT                   /translation="MNPGPRGRLCRRCFSCGYRLPILLPRHVDLVRVADCTHGGHTAAV
FT                   GAWPSWWGAVIQLVCGAALFLGLGTRITAFIASGSTAYAYFWSHQPDGVLPIQDNGELS
FT                   AIFCWALFLMIFLGAGALALDRLIARGGRTAQSGDGDDGTAGEQGPTTELREVNA"
     gtgaatccgg gaccgcgcgg tcgactatgc cgtcgctgct tttcgtgtgg ttatcggctt        60
     cctattcttc tgccacggca cgtcgacctt gttcgcgtgg ccgactgcac tcatggaggg       120
     cataccgcag cggtaggtgc ctggccgagt tggtggggcg cagtcatcca actcgtctgt       180
     ggcgccgcat tgttcctcgg cctggggaca cgaatcaccg cgttcattgc ctcgggttcg       240
     acggcgtacg cctacttctg gagtcatcag ccggacggcg tcctccccat ccaggacaac       300
     ggtgagctct cggccatctt ctgctgggcc ctgttcctga tgatcttcct cggcgccggc       360
     gctctcgcgc tcgatcgcct cattgctcgc ggtgggcgca cggcgcagtc gggcgacggc       420
     gacgacggca ccgccggcga acaaggacct accaccgaat tgcgtgaggt gaacgcctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page