(data stored in ACNUC7421 zone)

EMBL: CP000431.PE196

CP000431.PE196       Location/Qualifiers
FT   CDS_pept        complement(252739..253125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92032.1"
FT                   /translation="MNLIKKSAASVLVAATVTLGAGTAHADPVVPNTGTPALAIPGRHE
FT                   VDKQKALENMLNELGVGWANGGAAGTAIGALMGLGVGCISMFPGSLAGCIIGTPIGAIT
FT                   GAIVGIGQGNPRAQQAIQEYINTP"
     atgaacttga tcaagaaatc tgcagcgtcg gtcctcgtcg cagcgacggt gacactcggg        60
     gcgggtacgg cccacgccga cccagtcgta ccgaacacgg gaacgcctgc gctggcgatc       120
     cccggcaggc acgaggtcga caagcagaag gccctcgaga acatgctcaa cgagctcggc       180
     gtcggctggg ccaacggggg agcggccggg acggcgatcg gcgcgctcat gggtctcggc       240
     gtcggatgta tctcgatgtt ccccggcagt ctcgccggtt gcatcatcgg cacaccgatc       300
     ggggcgatca ccggcgcgat cgtcggtatc ggacagggca acccccgggc tcaacaggcc       360
     atccaggaat acatcaacac gccgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page